Basic Information | |
---|---|
Family ID | F100527 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 49 residues |
Representative Sequence | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP |
Number of Associated Samples | 70 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 80.39 % |
% of genes near scaffold ends (potentially truncated) | 33.33 % |
% of genes from short scaffolds (< 2000 bps) | 88.24 % |
Associated GOLD sequencing projects | 60 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (75.490 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.059 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (75.490 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 64.71% β-sheet: 0.00% Coil/Unstructured: 35.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF05272 | VirE | 5.88 |
PF13481 | AAA_25 | 4.90 |
PF01555 | N6_N4_Mtase | 3.92 |
PF07120 | DUF1376 | 1.96 |
PF09669 | Phage_pRha | 0.98 |
PF03747 | ADP_ribosyl_GH | 0.98 |
PF08774 | VRR_NUC | 0.98 |
PF07589 | PEP-CTERM | 0.98 |
PF02518 | HATPase_c | 0.98 |
PF07969 | Amidohydro_3 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG5545 | Predicted P-loop ATPase and inactivated derivatives | Mobilome: prophages, transposons [X] | 5.88 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.92 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.92 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.92 |
COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 1.96 |
COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 75.49 % |
All Organisms | root | All Organisms | 24.51 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 16.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 9.80% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 8.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.88% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062593_1000380654 | 3300004114 | Soil | MIAILCLLLAVVFALLSTTGIPEHPRWRFLSAAILFLALALLVGHLPWPPA* |
Ga0062593_1000471183 | 3300004114 | Soil | MIATLCLLLAVVFAALSATGVPEHPRWRFLSAAILFLALALLVGHLPWPAP* |
Ga0062589_1001171174 | 3300004156 | Soil | MIATLCLLVSLVFALLSATGVPEHPRWRHLSAALAFLVLALLLARLPWPAP* |
Ga0062589_1001689325 | 3300004156 | Soil | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWTAP* |
Ga0062589_1004849111 | 3300004156 | Soil | MIATLCLLLAVVFAALSTTGIPEYPRSRFLSAAILFLALALLVGHLPWPAP* |
Ga0062589_1005699301 | 3300004156 | Soil | MIAILCLLLAVVFALLSTTGIPEHPRWRFLSAAILFLALALLVGHLPW |
Ga0063356_1010820904 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP* |
Ga0062591_1001465531 | 3300004643 | Soil | MIATLCLLLAVVFAALSTTGIPEYPRSRFLSAAILFLALALLVGHL |
Ga0062594_1016278972 | 3300005093 | Soil | MLATLCLILALACALLSAAGIPEYRRWRPLSAAVAFIVLALLLARLPWPPS* |
Ga0062594_1021930473 | 3300005093 | Soil | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPAP* |
Ga0062594_1031580302 | 3300005093 | Soil | MIATLCLLIALVFALLSATGVPEHPRWRHLSAAIAFLVLALLLARLPWMPP* |
Ga0065714_103231352 | 3300005288 | Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPSP* |
Ga0065712_100781967 | 3300005290 | Miscanthus Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP* |
Ga0065715_100162473 | 3300005293 | Miscanthus Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPSP* |
Ga0065715_106254173 | 3300005293 | Miscanthus Rhizosphere | MIETLFLLIAAVFALLSTTGIPEHPRWYHLSAAILFLALALLVGHLPWPSP* |
Ga0070683_10000036030 | 3300005329 | Corn Rhizosphere | MIATLFLLLAVVFALLSTTGVPEHPRWHHLSAAILFLALALLAGHLPWPAP* |
Ga0070683_10000065120 | 3300005329 | Corn Rhizosphere | MIATLCLVVALAFALLSATGVPEHPRWRHLPAAIAFLVLALLLARLPWMPP* |
Ga0070690_1002429094 | 3300005330 | Switchgrass Rhizosphere | MIETLFLLIAVVFALLSTTGIPEHPRWYHLSAAILFLALALLVGHLPWPSP* |
Ga0070690_1005827981 | 3300005330 | Switchgrass Rhizosphere | MIATLCLLVALVFALLSATGVPEHPRWRFLSAAVAFLVLALLLARLPWPPS* |
Ga0070670_1001900961 | 3300005331 | Switchgrass Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPW |
Ga0070670_1013869253 | 3300005331 | Switchgrass Rhizosphere | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPPA* |
Ga0070666_106574432 | 3300005335 | Switchgrass Rhizosphere | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPPP* |
Ga0070691_106159831 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLVLALLVGHLPWSAP* |
Ga0070661_1004373721 | 3300005344 | Corn Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHHLSAAVLFLALALLVGHLPWPPA* |
Ga0070671_1004452323 | 3300005355 | Switchgrass Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPPP* |
Ga0070674_1002474523 | 3300005356 | Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVSHLPWPAP* |
Ga0070700_1008787862 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATLCLLVSLAFALLSATGVPEHPRWRFLSAAVAFLVLALLVARLPWTAP* |
Ga0070662_1011045052 | 3300005457 | Corn Rhizosphere | MIATLCLLISLVFALLSATGIPEHPRWRHLSAAIAFLVLALLLARLP* |
Ga0070685_109253893 | 3300005466 | Switchgrass Rhizosphere | RLRAAMIATLCLLVALVFALLSATGVPEHPRWRFLSAAVAFLVLALLLARLPWPAP* |
Ga0070685_109319362 | 3300005466 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRFLPAAIAFLVLALLLARLPWMPP* |
Ga0070684_1001285581 | 3300005535 | Corn Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHL |
Ga0070684_1002423934 | 3300005535 | Corn Rhizosphere | LIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWTAP* |
Ga0070672_1011958354 | 3300005543 | Miscanthus Rhizosphere | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALL |
Ga0070686_1003272531 | 3300005544 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRFLPAALAFLVLALLLARLPWPPS* |
Ga0070686_1005544052 | 3300005544 | Switchgrass Rhizosphere | MIATLFLLLSVVFALLSTTGIPQHPRWHHLSAAVLFLALALLVGHLPAWQP* |
Ga0070686_1009402581 | 3300005544 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRFLPAAVAFLVLALLLARLPWPPS* |
Ga0070664_1000951261 | 3300005564 | Corn Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHL |
Ga0068859_1008599072 | 3300005617 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRHLPAAIAFLVLALLLARLPWMPP* |
Ga0068866_101596981 | 3300005718 | Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALA |
Ga0068866_108420781 | 3300005718 | Miscanthus Rhizosphere | MIATLCLLVSLAFALLSATGVPEHPRWRFLSAAVAFLVLALLVA |
Ga0068861_1007930372 | 3300005719 | Switchgrass Rhizosphere | MIATLCLLISLVFALLSATGIPEHPRWRHLSAAIA |
Ga0068863_1019777073 | 3300005841 | Switchgrass Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFL |
Ga0068858_1006040533 | 3300005842 | Switchgrass Rhizosphere | MIATLCLLVALVFALLSATGVPEHPRWRFLSAAVAFLVLALLLARLPWPAP* |
Ga0068862_1005007464 | 3300005844 | Switchgrass Rhizosphere | CLLVSLVFALLSATGVPEHPRWRHLSAALAFLVLALLLARLPWPAP* |
Ga0068865_1013199221 | 3300006881 | Miscanthus Rhizosphere | LLAVVFAALSATGVPEHPRWRFLSAAILFLALALLVGHLPWPAP* |
Ga0111539_125408342 | 3300009094 | Populus Rhizosphere | MIATLCLLIALVFALLSATGVPEHPRWRHLSAAVAFLVLALLVARLPWPAP* |
Ga0105248_107715013 | 3300009177 | Switchgrass Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPPP* |
Ga0105238_101570784 | 3300009551 | Corn Rhizosphere | MIATLFLLIAVVFASLSTTGIPEHPRWHHLSAAIVFLVLALLLARLPWMPP* |
Ga0134124_113103171 | 3300010397 | Terrestrial Soil | LVSLVFALLSATGVPEHPRWRHLSAAVAFLVLALLVGHLPWPPA* |
Ga0134122_110235552 | 3300010400 | Terrestrial Soil | MLATLCLLIALVFALLSATGIPEHPRWHHLSAAILFLALALLVGHLPWPAP* |
Ga0134123_103245594 | 3300010403 | Terrestrial Soil | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWMPP* |
Ga0134123_113654232 | 3300010403 | Terrestrial Soil | MIATLCLLIAVVFALLSTTGVPEHPRWHHLSAAILFVALALLVGHLPWGAP* |
Ga0134123_117940031 | 3300010403 | Terrestrial Soil | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPEP* |
Ga0105246_118065501 | 3300011119 | Miscanthus Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPPA* |
Ga0157294_100241392 | 3300012892 | Soil | MIATLFLLIAVVFALLSTNGIPEHPRWHHLSAAILFLALALLVGHLPWPPA* |
Ga0157294_102355642 | 3300012892 | Soil | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAQ* |
Ga0157377_111935311 | 3300014745 | Miscanthus Rhizosphere | IAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPPP* |
Ga0157379_104488931 | 3300014968 | Switchgrass Rhizosphere | LFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP* |
Ga0132255_1022647992 | 3300015374 | Arabidopsis Rhizosphere | MIATLFLLLAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAQ* |
Ga0132255_1025106751 | 3300015374 | Arabidopsis Rhizosphere | ATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPSP* |
Ga0173479_104486772 | 3300019362 | Soil | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWTAP |
Ga0247800_10424903 | 3300023263 | Soil | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWTAP |
Ga0207697_100149677 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP |
Ga0207697_101345052 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRHLPAAIAFLVLALLLARLPWMPP |
Ga0207710_105399292 | 3300025900 | Switchgrass Rhizosphere | MIETLFLLIAVVFALLSTTGIPEHPRWYHLSAAILFLALALLVGHLPWPSP |
Ga0207688_105119622 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATLCLLLAVVFAALSATGVPEHPRWRFLSAAILFLALALLVGHLPWPAP |
Ga0207680_101147263 | 3300025903 | Switchgrass Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP |
Ga0207680_102795642 | 3300025903 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRFLPAAVAFLVLALLLARLPWPPS |
Ga0207680_103702591 | 3300025903 | Switchgrass Rhizosphere | MIATLCLLLAVVFAALSATGVPEHPRWRFLSAAILFLAL |
Ga0207662_102396753 | 3300025918 | Switchgrass Rhizosphere | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPAP |
Ga0207662_108122123 | 3300025918 | Switchgrass Rhizosphere | MIETLFLLIAAVFALLSTTGIPEHPRWYHLSAAILFLALALLVGHLPWPSP |
Ga0207649_111227203 | 3300025920 | Corn Rhizosphere | MIATLFLLLAVVFALLSTTGVPEHPRWHHLSAAILFLALALLAGHLPWPAP |
Ga0207681_102493852 | 3300025923 | Switchgrass Rhizosphere | MIATLCLLISLVFALLSATGIPEHPRWRHLSAAIAFLVLALLLARLP |
Ga0207650_113990351 | 3300025925 | Switchgrass Rhizosphere | ATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPPA |
Ga0207659_101248925 | 3300025926 | Miscanthus Rhizosphere | TLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAP |
Ga0207659_113786912 | 3300025926 | Miscanthus Rhizosphere | MIATLFLLIAVVFALLSTSGIPEHPRWHHLSAAILFLALA |
Ga0207701_101781301 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATLFLLLSVVFALLSTTGIPQHPRWHHLSAAVLFLALALLVGHLPAWQP |
Ga0207644_105703833 | 3300025931 | Switchgrass Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPPP |
Ga0207644_112343873 | 3300025931 | Switchgrass Rhizosphere | CLLIALVFALLSATGIPEHPRWRFLPAALAFLVLALLLARLPWPPS |
Ga0207644_114339243 | 3300025931 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRFLPAAIAFLVLALLLARLPWMPP |
Ga0207686_101809705 | 3300025934 | Miscanthus Rhizosphere | MIATLCLLVSLAFALLSATGVPEHPRWRFLSAAVAFLVLALLVARLPWTAP |
Ga0207669_101432764 | 3300025937 | Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVSHLPWPAP |
Ga0207669_118950312 | 3300025937 | Miscanthus Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPA |
Ga0207704_111441983 | 3300025938 | Miscanthus Rhizosphere | MIATLCLLIALVFALLSATGIPEHPRWRFLPAAIAFLVLALLLARLPWMPP |
Ga0207711_105772933 | 3300025941 | Switchgrass Rhizosphere | MIATLCLLLAVVFAALSATGIPEHPRWRFLSAAILFLALALLVGHLPWPAP |
Ga0207689_113720502 | 3300025942 | Miscanthus Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPAP |
Ga0207661_1000592412 | 3300025944 | Corn Rhizosphere | MIATLCLVVALAFALLSATGVPEHPRWRHLPAAIAFLVLALLLARLPWMPP |
Ga0207661_102303441 | 3300025944 | Corn Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGH |
Ga0207651_100269155 | 3300025960 | Switchgrass Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPPP |
Ga0207651_101302323 | 3300025960 | Switchgrass Rhizosphere | MIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLA |
Ga0207651_119859933 | 3300025960 | Switchgrass Rhizosphere | RATGAEMIATLFLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPSP |
Ga0207668_101335324 | 3300025972 | Switchgrass Rhizosphere | MIATLCLLIALVFALLSATGIPEHPRWRFLPAALAFLVLALLLARLPWPPS |
Ga0207703_105416013 | 3300026035 | Switchgrass Rhizosphere | MIATLCLLVALVFALLSATGVPEHPRWRFLSAAVAFLVLALLLARLPWPAP |
Ga0207641_104586334 | 3300026088 | Switchgrass Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPW |
Ga0207641_124238731 | 3300026088 | Switchgrass Rhizosphere | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLP |
Ga0268266_115044202 | 3300028379 | Switchgrass Rhizosphere | MLATLCLLIALVFALLSATGIPEHPRWRFLPAALAFLVLALLLARLPWPPS |
Ga0310887_103863201 | 3300031547 | Soil | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALL |
Ga0310887_108837471 | 3300031547 | Soil | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILF |
Ga0310907_108565851 | 3300031847 | Soil | MIATLCLLIAVVFALLSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPAQ |
Ga0310897_106465823 | 3300032003 | Soil | TLSLLVSLVFALLSATGIPEHPRWRHLSAAIAFLVLALLLARLPWMPP |
Ga0310890_100490092 | 3300032075 | Soil | MIATLCLLIALVFALLSATGIPEHPRWRHLSAAVAFLVLALLLARLPWPPA |
Ga0310896_104166083 | 3300032211 | Soil | LLIAVVFAALSTTGIPEHPRWHHLSAAILFLALALLVGHLPWPSP |
⦗Top⦘ |