| Basic Information | |
|---|---|
| Family ID | F100484 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYL |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.63 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.08 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.510 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF06723 | MreB_Mbl | 93.14 |
| PF02686 | Glu-tRNAGln | 2.94 |
| PF01425 | Amidase | 1.96 |
| PF13177 | DNA_pol3_delta2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 93.14 |
| COG0721 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit | Translation, ribosomal structure and biogenesis [J] | 2.94 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.24 % |
| Unclassified | root | N/A | 11.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10744781 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300001867|JGI12627J18819_10048426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1775 | Open in IMG/M |
| 3300001867|JGI12627J18819_10398636 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101396356 | Not Available | 593 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101627152 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005184|Ga0066671_10498780 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005534|Ga0070735_10612277 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005538|Ga0070731_10811932 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005541|Ga0070733_10339286 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005542|Ga0070732_10999181 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005577|Ga0068857_101641031 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005764|Ga0066903_104220932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 769 | Open in IMG/M |
| 3300005764|Ga0066903_105547819 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005764|Ga0066903_109048973 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006034|Ga0066656_10241604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1159 | Open in IMG/M |
| 3300006954|Ga0079219_11819857 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300009553|Ga0105249_11707656 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010048|Ga0126373_12059857 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010049|Ga0123356_12179975 | Not Available | 692 | Open in IMG/M |
| 3300010359|Ga0126376_10971941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300010371|Ga0134125_11828534 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010373|Ga0134128_12281893 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010376|Ga0126381_103378945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 629 | Open in IMG/M |
| 3300011120|Ga0150983_12708526 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300011120|Ga0150983_13229832 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300011120|Ga0150983_13421176 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300013307|Ga0157372_11287210 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300014658|Ga0181519_10396529 | Not Available | 852 | Open in IMG/M |
| 3300015051|Ga0137414_1003204 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300015054|Ga0137420_1262756 | Not Available | 1953 | Open in IMG/M |
| 3300016404|Ga0182037_10894445 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300016445|Ga0182038_11841445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 547 | Open in IMG/M |
| 3300017994|Ga0187822_10132718 | Not Available | 787 | Open in IMG/M |
| 3300017999|Ga0187767_10168143 | Not Available | 670 | Open in IMG/M |
| 3300020070|Ga0206356_11133889 | Not Available | 686 | Open in IMG/M |
| 3300020082|Ga0206353_11141286 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300020170|Ga0179594_10291605 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021178|Ga0210408_11213996 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300021405|Ga0210387_11681690 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300021406|Ga0210386_11268005 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300021444|Ga0213878_10335645 | Not Available | 652 | Open in IMG/M |
| 3300021477|Ga0210398_11501870 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021478|Ga0210402_10965022 | Not Available | 779 | Open in IMG/M |
| 3300021479|Ga0210410_11698949 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021560|Ga0126371_10956641 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300023275|Ga0247776_10362332 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300024288|Ga0179589_10204009 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300025711|Ga0207696_1029560 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 1672 | Open in IMG/M |
| 3300025898|Ga0207692_10255277 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300025912|Ga0207707_10024023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5330 | Open in IMG/M |
| 3300025928|Ga0207700_11684323 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300025928|Ga0207700_11816441 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300026041|Ga0207639_10226116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1619 | Open in IMG/M |
| 3300026142|Ga0207698_11296651 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300026322|Ga0209687_1178264 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026322|Ga0209687_1209603 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027070|Ga0208365_1029695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 719 | Open in IMG/M |
| 3300027266|Ga0209215_1033591 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027546|Ga0208984_1006332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2151 | Open in IMG/M |
| 3300027567|Ga0209115_1097123 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027590|Ga0209116_1053470 | Not Available | 874 | Open in IMG/M |
| 3300027616|Ga0209106_1144074 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027867|Ga0209167_10257546 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300027869|Ga0209579_10636958 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027889|Ga0209380_10803330 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027895|Ga0209624_11067972 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027986|Ga0209168_10618786 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030741|Ga0265459_13625261 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031122|Ga0170822_15206971 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031231|Ga0170824_124594544 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031474|Ga0170818_101566450 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031545|Ga0318541_10539713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 652 | Open in IMG/M |
| 3300031668|Ga0318542_10134065 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 1220 | Open in IMG/M |
| 3300031713|Ga0318496_10405364 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300031715|Ga0307476_10015887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4803 | Open in IMG/M |
| 3300031715|Ga0307476_11298730 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031723|Ga0318493_10596274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 615 | Open in IMG/M |
| 3300031769|Ga0318526_10074850 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 1327 | Open in IMG/M |
| 3300031777|Ga0318543_10549822 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031793|Ga0318548_10042895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2038 | Open in IMG/M |
| 3300031793|Ga0318548_10359535 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031819|Ga0318568_11029213 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031823|Ga0307478_10432082 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300031832|Ga0318499_10260523 | Not Available | 672 | Open in IMG/M |
| 3300031859|Ga0318527_10314283 | Not Available | 667 | Open in IMG/M |
| 3300031893|Ga0318536_10542136 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031941|Ga0310912_10150070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1758 | Open in IMG/M |
| 3300031945|Ga0310913_10654419 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300031946|Ga0310910_11392521 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031959|Ga0318530_10251627 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032009|Ga0318563_10514982 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032043|Ga0318556_10154421 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 1185 | Open in IMG/M |
| 3300032043|Ga0318556_10582075 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300032054|Ga0318570_10277031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 762 | Open in IMG/M |
| 3300032066|Ga0318514_10118549 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 1355 | Open in IMG/M |
| 3300032067|Ga0318524_10305622 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300032076|Ga0306924_11943185 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300032174|Ga0307470_11036473 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032805|Ga0335078_11278931 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300032892|Ga0335081_11129110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 900 | Open in IMG/M |
| 3300032955|Ga0335076_11279391 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300033805|Ga0314864_0159837 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 14.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.98% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107447812 | 3300001593 | Forest Soil | VAAFGTGVGRPLGRGGSAGFRFTFFAILSVVAMYLDQRAH |
| JGI12627J18819_100484261 | 3300001867 | Forest Soil | VTAFGTAAGRPLQGRGGSPGFRFFLYAVFAVVIMYLDQRARYLEHV |
| JGI12627J18819_103986362 | 3300001867 | Forest Soil | VAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIMMYLD |
| JGIcombinedJ26739_1013963562 | 3300002245 | Forest Soil | VAAFGTVGRPLGRGGSPGFRFTLFAILSVVAMYLDQRQHYLERVRYVLGA |
| JGIcombinedJ26739_1016271521 | 3300002245 | Forest Soil | MAFGTGASSARGGSPGFRFALYAILSIVIMFLDQRW |
| Ga0066671_104987802 | 3300005184 | Soil | VAAFGTPAGRPWQGRGGSAGFRYTLYAAVAVVVMYLDQRQHYLEQV |
| Ga0070735_106122772 | 3300005534 | Surface Soil | LAAFGTGARQLQGRGGSPGFRFTIYALLSIVIMFLDERSHWLENAR |
| Ga0070731_108119321 | 3300005538 | Surface Soil | VAAFGTAAGRPLTGRGGSPGFRFTLYALLAVVVMYLDQRQHYL |
| Ga0070733_103392861 | 3300005541 | Surface Soil | VAAFGTVPGRPLQGRGGSPGFRFTVYALLSVVGMYLDQR |
| Ga0070732_109991811 | 3300005542 | Surface Soil | MAAFGTGASRQLSGRGSAPGFRFTIYAALSIVVMFMDKRGEYFERVHYV |
| Ga0068857_1016410312 | 3300005577 | Corn Rhizosphere | VAAFGTGASSRSLQGRGGSAGFRFTLYAILSVVVMFLDQRQGW |
| Ga0066903_1042209321 | 3300005764 | Tropical Forest Soil | VAAFGTGAGRPPSGRGGSPGFRFTLYALLSVILMYLDQRAHYLEQ |
| Ga0066903_1055478191 | 3300005764 | Tropical Forest Soil | VAAFGTGAGRPLQGRGGSGFRFTLYALLAVVVMYFDQRGHYLEQVRYALQAAAYPI |
| Ga0066903_1090489732 | 3300005764 | Tropical Forest Soil | VAAFGTGASRQLQGRGGSPGFRFTIYAVLSIVVMFLDERSHWLESARYVLQAAAY |
| Ga0066656_102416042 | 3300006034 | Soil | VAAFGTAAGRPLQGRDGAAGFRFTVYAALAVVIMYLDQRQHYLERLRYVL |
| Ga0079219_118198572 | 3300006954 | Agricultural Soil | MAFGTGASSARGGSPGFRFTVYATLSIVIMFLDQRGEYLEQ |
| Ga0105249_117076562 | 3300009553 | Switchgrass Rhizosphere | MAFGTGASSARGGSPGFRFTLYAILSIVIMFLDQKGEYLE |
| Ga0126373_120598571 | 3300010048 | Tropical Forest Soil | VAAFGTGAGRPLSGRGGSPGFRFTLFAVLSVVIMYLDQRGHYLERV |
| Ga0123356_121799751 | 3300010049 | Termite Gut | VAAFGTGAPRPLPGRGGTGSPGFRFTLYALLSVVVMYLDQRQHYLEQLR |
| Ga0126376_109719411 | 3300010359 | Tropical Forest Soil | VAAFGTAAGRPLTGRGGSPGFRFTLFALLAVVVMYLDQRQHYLEQVRY |
| Ga0134125_118285342 | 3300010371 | Terrestrial Soil | VAAFGTGASRQLQGRGGSPGFRFTLYALLSIVVMFLDERSHWLENARYVLQA |
| Ga0134128_122818931 | 3300010373 | Terrestrial Soil | VAAFGTGAGRPLSGRGGSPGFRFTLYALLSVILMYLDQRAHYLEQL |
| Ga0126381_1033789451 | 3300010376 | Tropical Forest Soil | VAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIMMYLDQR |
| Ga0150983_127085261 | 3300011120 | Forest Soil | VTAFGTAAGRPLQGRGGSPGFRFTLYGAVAVVIMYLDQRAHYLE |
| Ga0150983_132298322 | 3300011120 | Forest Soil | VAAFGTGAGRPSGRGGSPGFRFTLFAVLSVITMYLDQRQHYLEQVRYVLQAA |
| Ga0150983_134211761 | 3300011120 | Forest Soil | VAAFGTAAGRPLGRGGSPGFRFTLYAAVAVVVMYLDQRQHYLEQLRYVLQ |
| Ga0157372_112872101 | 3300013307 | Corn Rhizosphere | LAAFGTGARQLQGRGGSPGFRFFLYALLSIVVMFLDERSHWL |
| Ga0181519_103965291 | 3300014658 | Bog | VAAFGTGAGRPLYGRGGSPGFKFTIYAVLSVVAMYLDQRQHYLEH |
| Ga0137414_10032042 | 3300015051 | Vadose Zone Soil | MAFGTGASSARGGSPGFRFALYAILSIVIMFLDQKG |
| Ga0137420_12627561 | 3300015054 | Vadose Zone Soil | VAAFGTAAGRPLQGRGGAAGFGFRFALYAALAVVVMYLDQRQHYLERVRYVLQA |
| Ga0182037_108944451 | 3300016404 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIVVYLDQRAHYLEQ |
| Ga0182038_118414451 | 3300016445 | Soil | VAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIMMYLDQRAHYLEQ |
| Ga0187822_101327182 | 3300017994 | Freshwater Sediment | VAFGTAAGRPLQGRGGSPGFRFTLYAVLSVVVMYL |
| Ga0187767_101681431 | 3300017999 | Tropical Peatland | VTAFGTAASRPLQGRGGSPGFRFTLYAVLAVVVMYLD |
| Ga0206356_111338892 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAFGTGSRSLQGRGGSAGFRFTLYAVLSVVVMFLDQR |
| Ga0206353_111412862 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAFGTGARQLQGRGGSPGFRFTLYALLSIVIMFLDERSHWLE |
| Ga0179594_102916052 | 3300020170 | Vadose Zone Soil | VAAFGTPAGRPWQGRGGSAGLRFTLYAAVAVVVMYLDQRQHYLEQL |
| Ga0210408_112139961 | 3300021178 | Soil | VAAFGTAASRPLQGRGGSSGFHFTLYATLAVVAMYLD |
| Ga0210387_116816901 | 3300021405 | Soil | VAAFGTGGSRSVSRGPSPGFRFTLYAILSFVVMFLDQRHGWM |
| Ga0210386_112680051 | 3300021406 | Soil | VAAFGTAAGRPLQGRGGSPGFRFTLYGAVAVVIMYLDQRAHYLEP |
| Ga0213878_103356451 | 3300021444 | Bulk Soil | VAAFGTAGGRALGRGSPGFRFTLFALLSVIAMYLDQR |
| Ga0210398_115018702 | 3300021477 | Soil | VAFGTPGSRSQVRGPSPGFRFTLYAFLSFVIMFLDQRHGW |
| Ga0210402_109650221 | 3300021478 | Soil | MAFGTGASSARGGSPGFRFTIYAILSIVIMFLDQRGAYL |
| Ga0210410_116989492 | 3300021479 | Soil | MAFGTGASSARGGSPGFRFAIYAILSIVIMFLDQRGSWLE |
| Ga0126371_109566411 | 3300021560 | Tropical Forest Soil | VAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIVMYLDQRAHYLEQV |
| Ga0247776_103623322 | 3300023275 | Plant Litter | MAFGTGASSARGGSPGFRFTLYAIISIVIMFLDQK |
| Ga0179589_102040092 | 3300024288 | Vadose Zone Soil | MAFGTGASSARGGSPGFQFTLYAILSVVIMFLDQK |
| Ga0207696_10295601 | 3300025711 | Switchgrass Rhizosphere | MAFGTGASSARGGSPGFRFTLYAALSIIIMFLDQR |
| Ga0207692_102552771 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAFGTGASRHLQGRGGSPGFRFFLYALLSMVVMFLDQ |
| Ga0207707_100240231 | 3300025912 | Corn Rhizosphere | VAAFGTGARQLQGRGGSPGFRFTLYALLSIVIMFLDERSHWLENARYF |
| Ga0207700_116843232 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VAFGTGAGRPLQGRGGSPGFRFTLYAVLSVVVMYLDQRQHYLE |
| Ga0207700_118164412 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAFGTGGSRSQVRGPSLGFRFTLYAILSMVVMFLDQ |
| Ga0207639_102261163 | 3300026041 | Corn Rhizosphere | VAAFGTGARQLQGRGGSPGFRFTLYALLSIVIMFLDERSHWLENARYFLQAAAYP |
| Ga0207698_112966511 | 3300026142 | Corn Rhizosphere | VAGFATGAGRPLQGRGGSPGFRFALYAILSIAFMVLDQRFDWLERAHSVMQA |
| Ga0209687_11782641 | 3300026322 | Soil | VAAFGTAAGRPLQGRGGSPGFRFTLYAVLSIVVMFLD |
| Ga0209687_12096032 | 3300026322 | Soil | VAAFGTPAGRPWQARGGSAGFRFTLYAAVAVVVMYLDQRQHY |
| Ga0208365_10296951 | 3300027070 | Forest Soil | VAAFGTAAGRPLGRGGSPGLRFTLYAALAVVAMYLDQRQ |
| Ga0209215_10335912 | 3300027266 | Forest Soil | VAAFGTGAGRPLVGRGGSPGFRFTLYALLSVIVMYLDQRAHYLEQVRYVL |
| Ga0208984_10063321 | 3300027546 | Forest Soil | VAAFGTPAGRPWQGRGGSAGFRFTLYAAVAVVVMYLDQRQHYLEQLRY |
| Ga0209115_10971231 | 3300027567 | Forest Soil | VAFGTPGSRSQVRGPSPGFRFTLYAFLSFVIMFLDQRHGWME |
| Ga0209116_10534702 | 3300027590 | Forest Soil | VAAFGTGVGRPLGRGGSAGFRFTFFAILSVVAMYLD |
| Ga0209106_11440741 | 3300027616 | Forest Soil | VAAFGTPAGRPWQGRGGSAGFRFTLYAAVAVVVMYLDQRQHYLE |
| Ga0209167_102575461 | 3300027867 | Surface Soil | VAAFGTVPGRPLQGRGGSPGFRFTVYALLSVVAMYLDQRQ |
| Ga0209579_106369581 | 3300027869 | Surface Soil | VAAFGTAAGRPLTGRGGSPGFRFTLYALLAVVVMYLDQRQH |
| Ga0209380_108033302 | 3300027889 | Soil | VAAFGTGASRPLQRGGSGFRFTVYAVLAVVCMYFDQRGHYLEQVRYV |
| Ga0209624_110679721 | 3300027895 | Forest Soil | VAAFGTVGRPLGRGGSPGFRFTLFAILSVVAMYLDQRQHYLER |
| Ga0209168_106187861 | 3300027986 | Surface Soil | VAGFATGAGRPLEGRRGSPGFRFALYAIVSIAFMILDQR |
| Ga0265459_136252611 | 3300030741 | Soil | VAAFGTGVGRPLGRGGSAGFRFTFFAILSVVAMYLDQRAHYLEQVRYVLL |
| Ga0170822_152069712 | 3300031122 | Forest Soil | VAAFGTGGGRPLQARGGSAGFRFTLYAMLAVMVMYLDQR |
| Ga0170824_1245945441 | 3300031231 | Forest Soil | VAAFGTGASRQLQGRGGSLGFRFTLYALLSMVVMFLDERSHWLESSRYVLQAA |
| Ga0170818_1015664501 | 3300031474 | Forest Soil | VAAFGTGASRQLQGRGGSLGFRFTLYALLSMVVMF |
| Ga0318541_105397131 | 3300031545 | Soil | VAAFGTGAGRPLSGRGGSPGFRFTLYALLSVIAMYLDQRAHY |
| Ga0318542_101340651 | 3300031668 | Soil | VAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIVMYLDQR |
| Ga0318496_104053642 | 3300031713 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIVMYLDQRAHYLE |
| Ga0307476_100158871 | 3300031715 | Hardwood Forest Soil | MAFGTGATSGRGGSPGFRFTLYATVSIIIMFLDQRGEYLE |
| Ga0307476_112987301 | 3300031715 | Hardwood Forest Soil | MAFGTGASSSRGGSPGFRFALYAILSIVIMFLDQRGNYLEQ |
| Ga0318493_105962741 | 3300031723 | Soil | VAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIMMY |
| Ga0318526_100748501 | 3300031769 | Soil | VAAFGTGAGRPLGGRGGSAGFRFTLYALLSVIMMYLDQRAH |
| Ga0318543_105498221 | 3300031777 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRA |
| Ga0318548_100428954 | 3300031793 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYLEQ |
| Ga0318548_103595352 | 3300031793 | Soil | VAAFGTGAGRLAGRGGSPGFRFTLYALLSVIVMYLDQRAH |
| Ga0318568_110292131 | 3300031819 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHY |
| Ga0307478_104320822 | 3300031823 | Hardwood Forest Soil | VAAFGTAGRPLQGRGGSGFRFTLYALLAVLTMYFDQRGHYLEQVRYVLQAAAYPI |
| Ga0318499_102605232 | 3300031832 | Soil | VAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIMMYLDQRAHYLEQVR |
| Ga0318527_103142831 | 3300031859 | Soil | VAAFGTGAGRLAGRGGSPGFRFTLYALLSVIVMYLDQRAHYLE |
| Ga0318536_105421361 | 3300031893 | Soil | VAAFGTGAGRPLSGRGGSPGFRFTLFAVLSVVIMY |
| Ga0310912_101500701 | 3300031941 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQ |
| Ga0310913_106544192 | 3300031945 | Soil | VAAFGTGAGRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYL |
| Ga0310910_113925212 | 3300031946 | Soil | VAAFGTGADRPLGGRSGSPGFRFTLYALLSVIVMYLDQRAHYLEQVRY |
| Ga0318530_102516272 | 3300031959 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMYLDQRAHYLEQVRYVL |
| Ga0318563_105149822 | 3300032009 | Soil | VAAFGTGAGRPLGGRGGSAGFRFTLYALLSLIVMYLDQRAHYLEQV |
| Ga0318556_101544212 | 3300032043 | Soil | VAAFGTGADRPLGGRGGSPGFRFTLYALLSVIAMY |
| Ga0318556_105820751 | 3300032043 | Soil | VAAFGTGAGRPLTGRGGSPGFRFTLYALLSVIVMYLDQRAHY |
| Ga0318570_102770312 | 3300032054 | Soil | VAAFGTGAGRPLSGRGGSPGFRFTLYALLSVIAMYLDQRAHYLEQVRY |
| Ga0318514_101185492 | 3300032066 | Soil | VAAFGTGADRPLGGRSGSPGFRFTLYALLSVIVMYLDQRAHYLE |
| Ga0318524_103056222 | 3300032067 | Soil | VAAFGTGAGRPLTGRGGSPGFRFTLYALLSVVAMYLDQRAHYLEQLRY |
| Ga0306924_119431851 | 3300032076 | Soil | VAAFGTGADRPLGGRSGSPGFRFTLYALLSVIVMYLDQRAHYLEQVR |
| Ga0307470_110364731 | 3300032174 | Hardwood Forest Soil | VAAFGTGASRPLYGRGGSGFRFTFYALLSVVAMYLDQRGHYLEQVRYVLQG |
| Ga0335078_112789311 | 3300032805 | Soil | VAAFGTAAGRPLTGRGGSPGFRFTLYALLSVVVMYLDQRQHYLEQVRY |
| Ga0335081_111291101 | 3300032892 | Soil | VAAFGTGAGRPLQGRGGSPGFRFTLYAVLSVVIMYLDQRQ |
| Ga0335076_112793911 | 3300032955 | Soil | MAFGTGASSARGGSPGFRFTLYAIVSIVIMFLDQRGEY |
| Ga0314864_0159837_2_130 | 3300033805 | Peatland | MAAFGTAAGRPLQGRGGSPGFRFTLYGVLAVAIMYLDQRAHYL |
| ⦗Top⦘ |