| Basic Information | |
|---|---|
| Family ID | F100440 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MNLYDKIMALYPELTTQDFLTVITLQNDSDGKGDYIA |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 98.04 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (66.667 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.745 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.647 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.54% β-sheet: 9.23% Coil/Unstructured: 69.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00386 | C1q | 8.82 |
| PF13884 | Peptidase_S74 | 1.96 |
| PF16778 | Phage_tail_APC | 0.98 |
| PF07460 | NUMOD3 | 0.98 |
| PF16075 | DUF4815 | 0.98 |
| PF13392 | HNH_3 | 0.98 |
| PF09636 | XkdW | 0.98 |
| PF07120 | DUF1376 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.43 % |
| Unclassified | root | N/A | 21.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10183570 | Not Available | 564 | Open in IMG/M |
| 3300002091|JGI24028J26656_1012429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
| 3300002835|B570J40625_101076323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300002835|B570J40625_101201115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300002835|B570J40625_101451803 | Not Available | 564 | Open in IMG/M |
| 3300005239|Ga0073579_1141159 | Not Available | 513 | Open in IMG/M |
| 3300005580|Ga0049083_10287333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300005581|Ga0049081_10259297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300005581|Ga0049081_10311161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300005582|Ga0049080_10175300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300005582|Ga0049080_10228416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300005582|Ga0049080_10237616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300005805|Ga0079957_1235654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300006104|Ga0007882_10284176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300006106|Ga0007833_1084717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300006119|Ga0007866_1041438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300006123|Ga0007852_1011038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2167 | Open in IMG/M |
| 3300006123|Ga0007852_1122755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300007363|Ga0075458_10105271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300007542|Ga0099846_1008583 | All Organisms → Viruses → Predicted Viral | 4082 | Open in IMG/M |
| 3300008114|Ga0114347_1141604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300008120|Ga0114355_1104866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1102 | Open in IMG/M |
| 3300008120|Ga0114355_1136309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300008266|Ga0114363_1207691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300008267|Ga0114364_1061817 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300008450|Ga0114880_1054818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1670 | Open in IMG/M |
| 3300009068|Ga0114973_10629054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300009155|Ga0114968_10157008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
| 3300009155|Ga0114968_10491215 | Not Available | 660 | Open in IMG/M |
| 3300009161|Ga0114966_10425478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300009164|Ga0114975_10003401 | All Organisms → Viruses | 10618 | Open in IMG/M |
| 3300009165|Ga0105102_10225694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 945 | Open in IMG/M |
| 3300009172|Ga0114995_10275887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300009180|Ga0114979_10654565 | Not Available | 597 | Open in IMG/M |
| 3300009785|Ga0115001_10626239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300010354|Ga0129333_10284329 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300010356|Ga0116237_10689294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300010368|Ga0129324_10433739 | Not Available | 505 | Open in IMG/M |
| 3300010370|Ga0129336_10197423 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300011010|Ga0139557_1065795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300013010|Ga0129327_10495322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300013094|Ga0164297_10302784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300013286|Ga0136641_1192767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300013372|Ga0177922_10620119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300013372|Ga0177922_11265021 | Not Available | 546 | Open in IMG/M |
| 3300015050|Ga0181338_1041132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300017722|Ga0181347_1061206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300017736|Ga0181365_1089132 | Not Available | 752 | Open in IMG/M |
| 3300017736|Ga0181365_1106816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300017754|Ga0181344_1206225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300017761|Ga0181356_1165157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300017761|Ga0181356_1199524 | Not Available | 593 | Open in IMG/M |
| 3300017774|Ga0181358_1181049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300017777|Ga0181357_1287824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300017778|Ga0181349_1157861 | All Organisms → Viruses | 810 | Open in IMG/M |
| 3300017778|Ga0181349_1221981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300017778|Ga0181349_1249689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300017784|Ga0181348_1242896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300017784|Ga0181348_1299677 | Not Available | 539 | Open in IMG/M |
| 3300018410|Ga0181561_10106374 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
| 3300019784|Ga0181359_1008746 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3509 | Open in IMG/M |
| 3300019784|Ga0181359_1188685 | Not Available | 674 | Open in IMG/M |
| 3300019784|Ga0181359_1230663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300020048|Ga0207193_1559809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300020048|Ga0207193_1812793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300020205|Ga0211731_11479911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
| 3300020683|Ga0214234_102131 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300020735|Ga0214219_1061264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300021136|Ga0214167_1040247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300021960|Ga0222715_10495368 | Not Available | 649 | Open in IMG/M |
| 3300021961|Ga0222714_10246022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300022190|Ga0181354_1164144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300022200|Ga0196901_1032172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2041 | Open in IMG/M |
| 3300022200|Ga0196901_1061489 | Not Available | 1378 | Open in IMG/M |
| 3300022925|Ga0255773_10294280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300023184|Ga0214919_10693216 | Not Available | 579 | Open in IMG/M |
| 3300024346|Ga0244775_11487593 | Not Available | 518 | Open in IMG/M |
| 3300025385|Ga0207956_1042376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300025426|Ga0208739_1048898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300025598|Ga0208379_1043090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
| 3300025778|Ga0208388_1051364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300025778|Ga0208388_1053764 | Not Available | 567 | Open in IMG/M |
| 3300025880|Ga0209534_10421099 | Not Available | 571 | Open in IMG/M |
| 3300026130|Ga0209961_1063579 | Not Available | 687 | Open in IMG/M |
| 3300027138|Ga0255064_1067188 | Not Available | 558 | Open in IMG/M |
| 3300027594|Ga0255120_1078311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300027732|Ga0209442_1262068 | Not Available | 613 | Open in IMG/M |
| 3300027734|Ga0209087_1127149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300027764|Ga0209134_10028777 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
| 3300027798|Ga0209353_10126276 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300027896|Ga0209777_10966479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300027896|Ga0209777_11145893 | Not Available | 523 | Open in IMG/M |
| 3300031885|Ga0315285_10745103 | Not Available | 623 | Open in IMG/M |
| 3300031885|Ga0315285_10977906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300032561|Ga0316222_1169466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300033996|Ga0334979_0468948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300034012|Ga0334986_0212728 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300034061|Ga0334987_0183218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1493 | Open in IMG/M |
| 3300034062|Ga0334995_0654438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300034104|Ga0335031_0000547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29156 | Open in IMG/M |
| 3300034118|Ga0335053_0822433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300034284|Ga0335013_0696333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 9.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.88% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.96% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.98% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.98% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.98% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.98% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006106 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020683 | Freshwater microbial communities from Trout Bog Lake, WI - 08JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025385 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_101835702 | 3300000949 | Macroalgal Surface | MMNLYEKIKAIYPELTDRDFMTVITLQNDSDGKGDY |
| JGI24028J26656_10124291 | 3300002091 | Lentic | MLYSKIMALYPSLTQQDFLTVVTLQNDSDGKGDYIAKWEHPT |
| B570J40625_1010763232 | 3300002835 | Freshwater | MNLFQKIMALYPSLTPQDFNINGTIVLRNDSDGNGDYIKSW |
| B570J40625_1012011151 | 3300002835 | Freshwater | MSLYEKIIALYPELKDYNFAFGDIRLQNDSDGKGDYIAKWEHT |
| B570J40625_1014518031 | 3300002835 | Freshwater | MLYDKIMALYPSLTQQDFMTVITLQNDSDGKGDYIAKWEH |
| Ga0073579_11411592 | 3300005239 | Marine | MSLYDKIIALYPELADYDFAMGDITLQNDSDGKGDYIAKW |
| Ga0049083_102873332 | 3300005580 | Freshwater Lentic | MNLYDKIMALYPSLTQQDFLTVIRLQNDSDGKGDYI |
| Ga0049081_102592972 | 3300005581 | Freshwater Lentic | MNLYEKIIDLYPELANFDFASGVITLQNDLDEKGDYIAK |
| Ga0049081_103111612 | 3300005581 | Freshwater Lentic | MTLYDKIMALYPALTQQDFLTTITLQNDSDGRGDYI |
| Ga0049080_101753001 | 3300005582 | Freshwater Lentic | MTLYEKIKSIYPQLTDNDFLTTIRLQNDSDGKGDYI |
| Ga0049080_102284162 | 3300005582 | Freshwater Lentic | MTLYEKIKTIYPELQDADFLDTIRLQNDSDGKGDYIAFW |
| Ga0049080_102376161 | 3300005582 | Freshwater Lentic | MTLYDKIKTLYTELTDHDFMTVITLQNDSDGKGDYIAK |
| Ga0079957_12356541 | 3300005805 | Lake | MTLSQKIKSIYPELTDRDFTTVITLQNDSDGNVGIF* |
| Ga0007882_102841762 | 3300006104 | Freshwater | MTLYDKIKSIYPSLENNDFVTVITLQNDSNGAGDYIK |
| Ga0007833_10847171 | 3300006106 | Freshwater | MLYEKIIALYPSLTQQDFLTVITLQNDSNGAGDYI |
| Ga0007866_10414383 | 3300006119 | Freshwater | MTLYDKIKAIYPNLEDKDFMTVITLQNNSDGKGDY |
| Ga0007852_10110386 | 3300006123 | Freshwater | MYEKLIKLYPELATFDFASRLIVIQNDSDGKGDYIAKWE |
| Ga0007852_11227552 | 3300006123 | Freshwater | MYEKLIKLYPELANFDFAGGVITLQNDSNGAGDYIKA |
| Ga0075458_101052712 | 3300007363 | Aqueous | MMTLYDKIKALYPELQDADFMDTIRLQNDSDGRGDYI |
| Ga0099846_10085834 | 3300007542 | Aqueous | MNLYDKIMALYPELTTQDFLTVITLQNDSDGKGDYIA |
| Ga0114347_11416043 | 3300008114 | Freshwater, Plankton | MTLYEKIKTIYPQLTDNDFFTVIILQNDSDGRGDYIAK |
| Ga0114355_11048661 | 3300008120 | Freshwater, Plankton | MTLYDKIKSIYPQLTDNDFMTVIRLQNDSDGRGDYIAKW |
| Ga0114355_11363091 | 3300008120 | Freshwater, Plankton | MTLYEKIKQLYPELTDNDFLTVITLQNDSDGRGDYIA |
| Ga0114363_12076911 | 3300008266 | Freshwater, Plankton | MMTLYEKIKQLYPSLTDKDFMTVITLQNDSDGKGD |
| Ga0114364_10618171 | 3300008267 | Freshwater, Plankton | MMTLPEKIKSLYPSLEDKDFMTTILLQNDSDGKGD |
| Ga0114880_10548185 | 3300008450 | Freshwater Lake | MLYEKIISIYPELANFDFASGVITLQNDSDGKGDYIAKWEH |
| Ga0114973_106290542 | 3300009068 | Freshwater Lake | MLYDKIKTLYPELTDHDFMTVITLQNDSDGKGDYIAKW |
| Ga0114968_101570081 | 3300009155 | Freshwater Lake | MLYEKIMAIYPQLEPQDFLTVITLQNDSDGKDDYIAK |
| Ga0114968_104912151 | 3300009155 | Freshwater Lake | MTLYDKIISIYPVLATYDFAMGAITLQDNSDGQGPYIAKWE |
| Ga0114966_104254782 | 3300009161 | Freshwater Lake | MNLYEKVMAIYPQLENKDFMTFITLQNDSNGKGDYI |
| Ga0114975_100034011 | 3300009164 | Freshwater Lake | MTLYEKIISLYPELATYDFAFGAITLQNDSDGKGDYI |
| Ga0105102_102256941 | 3300009165 | Freshwater Sediment | MYEKIINLYPSLTDKDFTTVITLQNDGDGDYIAKWEHP |
| Ga0114995_102758871 | 3300009172 | Marine | MTLYEKVMALHPELIDRDFLTVITLQNDSDDRGDYIAA |
| Ga0114979_106545652 | 3300009180 | Freshwater Lake | MLYDKIIAIYPELANFDFAKGVITLQNDGNGDYIAK |
| Ga0115001_106262392 | 3300009785 | Marine | MLYDKIMGLYPELTQQDFLYVIILQNDSDGKGDYI |
| Ga0129333_102843294 | 3300010354 | Freshwater To Marine Saline Gradient | MTLYDKIIALYPELQPQDFMTVIALQNDSDGRGDYI |
| Ga0116237_106892943 | 3300010356 | Anaerobic Digestor Sludge | MLYDKIMALYPELTQQDFLTVITLQNDSDGKGDYIAK |
| Ga0129324_104337391 | 3300010368 | Freshwater To Marine Saline Gradient | MTLYDKIKALYPELTNSDFMTTIRLQNDSDGKGDYIA |
| Ga0129336_101974231 | 3300010370 | Freshwater To Marine Saline Gradient | MLYEKIIALYPELSTFDFASGVITLQNDSDGKGDYI |
| Ga0139557_10657951 | 3300011010 | Freshwater | MMTLYDKIKTLYPELTERDFTTVITLQNDSDGKGDYIAK |
| Ga0129327_104953222 | 3300013010 | Freshwater To Marine Saline Gradient | MTLYEKIIALYPELADYNFADGDIRLQNDSDGRGDYIK |
| Ga0164297_103027841 | 3300013094 | Freshwater | MLYNKIMAIYPSLTFEDFITFITLQNDSDGKGDYI |
| Ga0136641_11927672 | 3300013286 | Freshwater | MMLYDKIKSIYPQLTDKDFMTVICLQNDSDGKGDYIA |
| Ga0177922_106201191 | 3300013372 | Freshwater | MMTLPEKIKQLYPSLTQQDFLTVITLQNDSDGKGDYIAKW |
| Ga0177922_112650211 | 3300013372 | Freshwater | MLYDKIIAIHPSLTDKDFMTVITLQNDSDGKGDYI |
| Ga0181338_10411322 | 3300015050 | Freshwater Lake | MTLYEKIKALYPQLTERDFYTVIQLQNDSDGKGDYIAL |
| Ga0181347_10612061 | 3300017722 | Freshwater Lake | MNLYEKIMALYPSLKGEDFGGPFATIRLQNDLDGKGDYIAKWEH |
| Ga0181365_10891322 | 3300017736 | Freshwater Lake | MNLYEKIMALYPSLKGEDFGGPFATIRLQNDLDGKGDYIAKWE |
| Ga0181365_11068161 | 3300017736 | Freshwater Lake | MMTLYDKIKTLYPELTERDFTTVITLQNDSDGKGF |
| Ga0181344_12062252 | 3300017754 | Freshwater Lake | MTLYEKIIAIYPNLVDKDFMTVIALQNDSDGRGDYIA |
| Ga0181356_11651572 | 3300017761 | Freshwater Lake | MNLYEKIIDLYPELANFDFASGVITLQNDLDEKGDYIAKWE |
| Ga0181356_11995242 | 3300017761 | Freshwater Lake | MTLPEKIKALYPQLTDKDFVTVIRLQNDSDGKGDYIA |
| Ga0181358_11810492 | 3300017774 | Freshwater Lake | MNLYEKIKAIYPSLEDKDFWNVIALQDNLDGKGAFI |
| Ga0181357_12878242 | 3300017777 | Freshwater Lake | MTLYEKIKSIYPSLTDSDFMTAIQLQNDSDGKGDY |
| Ga0181349_11578611 | 3300017778 | Freshwater Lake | MTLYQKIISLYPELATYDFAFGAITLQNDSDGKGDY |
| Ga0181349_12219811 | 3300017778 | Freshwater Lake | MTLYDKIMALYPALTQQDFTTTIRLQNDSDGKGDY |
| Ga0181349_12496891 | 3300017778 | Freshwater Lake | MTLPEKIMALYPSLTQQDFLTVIRLQNDSDGRGDYIAK |
| Ga0181348_12428962 | 3300017784 | Freshwater Lake | MTLYEKIRALYPSLTQQDFLTVVRIQNNSDGKGDFIKE |
| Ga0181348_12996772 | 3300017784 | Freshwater Lake | MLYDKIIIIYPQLTDVDFITTIRLQNDSDGKGDYIAKWEH |
| Ga0181561_101063744 | 3300018410 | Salt Marsh | MTLYEKIKAIYPELQDADFLTVIRLQNDSDGCGDYIA |
| Ga0181359_10087461 | 3300019784 | Freshwater Lake | MTLHDKIKTLYPELTDGDFVNIIRLQNDSDERGDYIAKWEHPTL |
| Ga0181359_11886851 | 3300019784 | Freshwater Lake | MTLPEKIKALYPTLTERDFYTVITLQNDSDGKGDYIAKW |
| Ga0181359_12306632 | 3300019784 | Freshwater Lake | MTLYDKIKTLYTELTDHDFMTVITLQNDSDGKGDYIAKFSFPSS |
| Ga0207193_15598092 | 3300020048 | Freshwater Lake Sediment | MLYGQVMTLYPELTDRDFITVIRLQNDSDGKGDYIAKWEHPT |
| Ga0207193_18127931 | 3300020048 | Freshwater Lake Sediment | MTLYEKIMALYPELTSRDFMSTIRLQNDSDGKGDY |
| Ga0211731_114799113 | 3300020205 | Freshwater | MYEKIMALYPSLQPQDFLTVIRLQNDSDGKGDYIAKWE |
| Ga0214234_1021311 | 3300020683 | Freshwater | MALYPSLTQQDFSTVITLQNDSDGKGDYIAKWEHPT |
| Ga0214219_10612642 | 3300020735 | Freshwater | MLYDKIMALYPSLTQQDFLTVITLQNDSDGKGDYIAKW |
| Ga0214167_10402473 | 3300021136 | Freshwater | MLYDKIKTIYPSLEDKDFMTVITLQNDSDNRGDYI |
| Ga0222715_104953681 | 3300021960 | Estuarine Water | MSLYEKIIALYPELTDYDFYTVITLQNDSDGNGDYIAKW |
| Ga0222714_102460223 | 3300021961 | Estuarine Water | MNIYDKIMALYPSLTQQDFLTVITLQNDSDGKGDY |
| Ga0181354_11641442 | 3300022190 | Freshwater Lake | MSLYEKIIAIHPSLANIDFTTVIRLQDNSDGKGAYIAKWEHPT |
| Ga0196901_10321721 | 3300022200 | Aqueous | MTLYEKILSIYPELTDFDFASGVITLQNDSDGRGDYIK |
| Ga0196901_10614891 | 3300022200 | Aqueous | MLYDKIMALYPSLTQQDFLTVITLQNDSDGKGDYIAKWEH |
| Ga0255773_102942802 | 3300022925 | Salt Marsh | MMTLYEKIKEIYPELTNDDFIDNITLRNDSDGKGDYIAK |
| Ga0214919_106932162 | 3300023184 | Freshwater | MTLHQKIISLYPVLATYDFATGDIRLQNNSDGKGEYIA |
| Ga0244775_114875931 | 3300024346 | Estuarine | MILYEKIIKIYPELIGYDFAIKDIMLKNDSDGKGDY |
| Ga0207956_10423761 | 3300025385 | Freshwater | MLYEKIIALYPSLTQQDFLTVITLQNDSNGAGDYIK |
| Ga0208739_10488982 | 3300025426 | Freshwater | MALYDQIKATYPQLTEKDFMTVIRLQNDSDGKGDYIKS |
| Ga0208379_10430904 | 3300025598 | Freshwater | MALYDQIKAIYPQLTDNDFLTTIRLQNDSDGKGDYIAKW |
| Ga0208388_10513642 | 3300025778 | Freshwater | MTLYEKIMALYPSLIDIDFLTTIRLQNDSDGRGDYIAS |
| Ga0208388_10537642 | 3300025778 | Freshwater | MLYDKIMALYPSLTQQDFLTVITLQNDSDGKGDYI |
| Ga0209534_104210992 | 3300025880 | Pelagic Marine | MSLYKKIIALYPELADYDFAMGDITLQNDSNGKGDY |
| Ga0209961_10635792 | 3300026130 | Water | MSLYEKIIAIYPELSDYDFAMGDITLQNDSDGKGDYIAKWE |
| Ga0255064_10671882 | 3300027138 | Freshwater | MTMTLYDKIIAIYPELADQQQAFMDGTITLQNDSDGKGDYI |
| Ga0255120_10783112 | 3300027594 | Freshwater | MFLSKKIKTIYPELQDLDFLATICLQNDSDGKGDY |
| Ga0209442_12620682 | 3300027732 | Freshwater Lake | MTLYDKIISLYPELATYDFAFGAITLQNDSDGKGD |
| Ga0209087_11271493 | 3300027734 | Freshwater Lake | MMTLYDKIKILYPQLTDHDFMTVITLQNDSDGKGDY |
| Ga0209134_100287771 | 3300027764 | Freshwater Lake | MLYEQVMALYPELTQQDFMTTIRLQNDSDGKGDYIAK |
| Ga0209353_101262764 | 3300027798 | Freshwater Lake | MTLYDKITTLYPELTDVDFMFVITLQNDSDGKGDYI |
| Ga0209777_109664792 | 3300027896 | Freshwater Lake Sediment | MTLYEKIIKIYPELTEFDFVTVITLQNDSDGKGDYI |
| Ga0209777_111458931 | 3300027896 | Freshwater Lake Sediment | MTLYDKIIAIYPDLQPEDFFTVIRLQNDSDGNGDYIK |
| Ga0315285_107451031 | 3300031885 | Sediment | MNLYEKIIAIYPELTQDDFMTSIRLQNDSDGQGDY |
| Ga0315285_109779061 | 3300031885 | Sediment | MLYEKIKSIYPQLEDKDFLTTIRLQNDSDGKGDYIAKWG |
| Ga0316222_11694661 | 3300032561 | Freshwater | MTLYEKIISIYPSLTQQDFLTVITLQNDSDGKGDYIA |
| Ga0334979_0468948_3_113 | 3300033996 | Freshwater | MTLYDKIKALYPELQDADFMDTIRLQNDSDGKGDYIK |
| Ga0334986_0212728_969_1073 | 3300034012 | Freshwater | MMSLYDKIKALYPELTDRDFLTVIMLQNDSDGRGD |
| Ga0334987_0183218_1375_1491 | 3300034061 | Freshwater | MMTLYEKIKALYPELQDADFLATIRLQNDSDGKGDYIAK |
| Ga0334995_0654438_3_122 | 3300034062 | Freshwater | MLYDKIKALYPELTDNDFLTVITLQNDSDGKGDYIAKWEH |
| Ga0335031_0000547_29039_29155 | 3300034104 | Freshwater | MMTLYEKIKQLYPSLTDKDFWTVITLQNDSDGKGDYIAK |
| Ga0335053_0822433_407_511 | 3300034118 | Freshwater | MLSEKIKQLYPSLTQEDFITVIILQNNSDGKGDYI |
| Ga0335013_0696333_2_112 | 3300034284 | Freshwater | MLYDKIKQLYPELTNNDFLTTIRLQNDSDGKGDYIAK |
| ⦗Top⦘ |