NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F100210

Metagenome / Metatranscriptome Family F100210

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F100210
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 115 residues
Representative Sequence VPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Number of Associated Samples 78
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 56.86 %
% of genes near scaffold ends (potentially truncated) 30.39 %
% of genes from short scaffolds (< 2000 bps) 62.75 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.83

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.451 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(27.451 % of family members)
Environment Ontology (ENVO) Unclassified
(74.510 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(58.824 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.57%    β-sheet: 14.69%    Coil/Unstructured: 51.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.83
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.23.1.0: automated matchesd3jtea13jte0.84789
c.23.1.0: automated matchesd4d6ya_4d6y0.8451
c.23.1.1: CheY-relatedd1l5za11l5z0.84273
c.23.1.0: automated matchesd6swla_6swl0.84213
c.23.1.0: automated matchesd2rjna_2rjn0.83848


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01171ATP_bind_3 20.59
PF00117GATase 16.67
PF11741AMIN 2.94
PF01464SLT 2.94
PF01384PHO4 1.96
PF01865PhoU_div 1.96
PF00005ABC_tran 1.96
PF12804NTP_transf_3 0.98
PF13620CarboxypepD_reg 0.98
PF00483NTP_transferase 0.98
PF11154DUF2934 0.98
PF00977His_biosynth 0.98
PF00480ROK 0.98
PF13472Lipase_GDSL_2 0.98
PF13690CheX 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 20.59
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 20.59
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 20.59
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 20.59
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 20.59
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 20.59
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 1.96
COG1392Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 familyInorganic ion transport and metabolism [P] 1.96
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.45 %
UnclassifiedrootN/A22.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009519|Ga0116108_1229370Not Available543Open in IMG/M
3300009547|Ga0116136_1020227All Organisms → cellular organisms → Bacteria2187Open in IMG/M
3300009616|Ga0116111_1036231Not Available1534Open in IMG/M
3300009623|Ga0116133_1011045All Organisms → cellular organisms → Bacteria → Acidobacteria2234Open in IMG/M
3300009623|Ga0116133_1099028Not Available741Open in IMG/M
3300009630|Ga0116114_1028874Not Available1635Open in IMG/M
3300009639|Ga0116122_1072235Not Available1141Open in IMG/M
3300009644|Ga0116121_1005922All Organisms → cellular organisms → Bacteria4249Open in IMG/M
3300009645|Ga0116106_1085469All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300009646|Ga0116132_1215618Not Available583Open in IMG/M
3300009762|Ga0116130_1004397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6070Open in IMG/M
3300009762|Ga0116130_1007614All Organisms → cellular organisms → Bacteria4105Open in IMG/M
3300009764|Ga0116134_1176267All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300009824|Ga0116219_10734247Not Available539Open in IMG/M
3300009839|Ga0116223_10106762All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300010339|Ga0074046_10290673All Organisms → cellular organisms → Bacteria → Acidobacteria1006Open in IMG/M
3300010379|Ga0136449_100143937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4702Open in IMG/M
3300010379|Ga0136449_100320268All Organisms → cellular organisms → Bacteria2810Open in IMG/M
3300010379|Ga0136449_101478724All Organisms → cellular organisms → Bacteria → Acidobacteria1042Open in IMG/M
3300010379|Ga0136449_103270382Not Available624Open in IMG/M
3300010379|Ga0136449_104155260Not Available538Open in IMG/M
3300014153|Ga0181527_1009026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7550Open in IMG/M
3300014156|Ga0181518_10116847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1468Open in IMG/M
3300014156|Ga0181518_10144194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1282Open in IMG/M
3300014160|Ga0181517_10006339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus10154Open in IMG/M
3300014160|Ga0181517_10010776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7121Open in IMG/M
3300014161|Ga0181529_10000256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus79504Open in IMG/M
3300014164|Ga0181532_10266470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus979Open in IMG/M
3300014167|Ga0181528_10242216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus973Open in IMG/M
3300014199|Ga0181535_10009756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus9150Open in IMG/M
3300014199|Ga0181535_10305719All Organisms → cellular organisms → Bacteria → Acidobacteria947Open in IMG/M
3300014200|Ga0181526_10075623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2145Open in IMG/M
3300014491|Ga0182014_10332962All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300014491|Ga0182014_10335000All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300014492|Ga0182013_10055201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2975Open in IMG/M
3300014496|Ga0182011_10758966Not Available609Open in IMG/M
3300014638|Ga0181536_10049509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2785Open in IMG/M
3300014839|Ga0182027_10212891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2234Open in IMG/M
3300016750|Ga0181505_10859193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus744Open in IMG/M
3300017925|Ga0187856_1000650All Organisms → cellular organisms → Bacteria → Acidobacteria30583Open in IMG/M
3300017925|Ga0187856_1053338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1760Open in IMG/M
3300017931|Ga0187877_1091615All Organisms → cellular organisms → Bacteria → Acidobacteria1284Open in IMG/M
3300017935|Ga0187848_10121165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1173Open in IMG/M
3300017938|Ga0187854_10420439Not Available559Open in IMG/M
3300017941|Ga0187850_10132587Not Available1181Open in IMG/M
3300017946|Ga0187879_10012053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5483Open in IMG/M
3300017946|Ga0187879_10071861All Organisms → cellular organisms → Bacteria → Acidobacteria2008Open in IMG/M
3300017946|Ga0187879_10227020Not Available1044Open in IMG/M
3300017948|Ga0187847_10000017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus194651Open in IMG/M
3300017948|Ga0187847_10115818All Organisms → cellular organisms → Bacteria → Acidobacteria1471Open in IMG/M
3300017988|Ga0181520_10029150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5864Open in IMG/M
3300017988|Ga0181520_10043091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4433Open in IMG/M
3300017988|Ga0181520_10444455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans930Open in IMG/M
3300018013|Ga0187873_1229667Not Available689Open in IMG/M
3300018016|Ga0187880_1054537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2119Open in IMG/M
3300018016|Ga0187880_1214810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus865Open in IMG/M
3300018018|Ga0187886_1190991All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300018019|Ga0187874_10154327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus969Open in IMG/M
3300018020|Ga0187861_10020294All Organisms → cellular organisms → Bacteria → Acidobacteria4006Open in IMG/M
3300018022|Ga0187864_10011588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5859Open in IMG/M
3300018024|Ga0187881_10263647Not Available719Open in IMG/M
3300018026|Ga0187857_10130394All Organisms → cellular organisms → Bacteria → Acidobacteria1205Open in IMG/M
3300018033|Ga0187867_10049387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2536Open in IMG/M
3300018033|Ga0187867_10207233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1113Open in IMG/M
3300018035|Ga0187875_10042927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2661Open in IMG/M
3300018042|Ga0187871_10013861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5396Open in IMG/M
3300018042|Ga0187871_10179752All Organisms → cellular organisms → Bacteria → Acidobacteria1187Open in IMG/M
3300018043|Ga0187887_10012633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5633Open in IMG/M
3300018044|Ga0187890_10402237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus768Open in IMG/M
3300018060|Ga0187765_10195209Not Available1167Open in IMG/M
3300019788|Ga0182028_1305942All Organisms → cellular organisms → Bacteria1941Open in IMG/M
3300019788|Ga0182028_1537694All Organisms → cellular organisms → Bacteria → Acidobacteria1755Open in IMG/M
3300022524|Ga0224534_1000069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus68184Open in IMG/M
3300023068|Ga0224554_1015774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2441Open in IMG/M
3300023258|Ga0224535_1002424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5015Open in IMG/M
3300025442|Ga0208034_1025523All Organisms → cellular organisms → Bacteria → Acidobacteria1518Open in IMG/M
3300025444|Ga0208189_1025845All Organisms → cellular organisms → Bacteria → Acidobacteria1218Open in IMG/M
3300025496|Ga0208191_1108042Not Available562Open in IMG/M
3300025500|Ga0208686_1070518All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300027854|Ga0209517_10681552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus532Open in IMG/M
3300027905|Ga0209415_10036506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6837Open in IMG/M
3300027905|Ga0209415_10411771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1085Open in IMG/M
3300028574|Ga0302153_10170611Not Available745Open in IMG/M
3300028745|Ga0302267_10280668Not Available712Open in IMG/M
3300028748|Ga0302156_10016534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4477Open in IMG/M
3300028800|Ga0265338_10732154Not Available681Open in IMG/M
3300029907|Ga0311329_10113493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2208Open in IMG/M
3300029911|Ga0311361_10001214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus55094Open in IMG/M
3300030508|Ga0302185_10284519Not Available557Open in IMG/M
3300030518|Ga0302275_10633959Not Available511Open in IMG/M
3300031250|Ga0265331_10055227All Organisms → cellular organisms → Bacteria → Acidobacteria1889Open in IMG/M
3300031259|Ga0302187_10075535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1996Open in IMG/M
3300032160|Ga0311301_11676246All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300032160|Ga0311301_12246057Not Available624Open in IMG/M
3300032805|Ga0335078_10266983All Organisms → cellular organisms → Bacteria → Acidobacteria2323Open in IMG/M
3300032805|Ga0335078_10588493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1406Open in IMG/M
3300032805|Ga0335078_11306020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus828Open in IMG/M
3300033402|Ga0326728_10013398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus17816Open in IMG/M
3300033405|Ga0326727_10990620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus615Open in IMG/M
3300033818|Ga0334804_042818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1360Open in IMG/M
3300033823|Ga0334837_085475All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300033977|Ga0314861_0073148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1818Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland27.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland16.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog14.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil11.76%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.84%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.90%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.94%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030508Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0116108_122937023300009519PeatlandKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV*
Ga0116136_102022723300009547PeatlandMCAFDDRIIMPEKSASGCVLVVEDPFIRRFVGGVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPAHFCEFAETLPLIYVATFPDPELADRFRCCRTLHKPFRPSDLAACAAELAPTEDV*
Ga0116111_103623113300009616PeatlandRFVGGVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPAHFCEFAETLPLIYVATFPDPELADRFRCCRTLHKPFRPSDLAACAAELAPTEDV*
Ga0116133_101104523300009623PeatlandMQSTTASGCVLIVEDPMIQRFVGGVLKREGYDVAEAELEEALLALRAGSGAVSLLITNRPASFLEFAETLPLVYVAAFPDPALTARFRRCRVLRKPFDPGDLAQCAAELAGPVAV*
Ga0116133_109902813300009623PeatlandMQQKAALGCALIVEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADGFRRCRVLRKPFRPSDLALCAAELAPPVLTF*
Ga0116114_102887433300009630PeatlandMQQKAALGCALIVEDPIIRRFVGGILKREGYTVAEAELEEALRTLRDAPGAVSLLITNGPAHFLEFAESLPLIYVAAFPDPALASRFRHCRTLRKPFCPGDLVLCAAELAQAVAV*
Ga0116122_107223523300009639PeatlandMPEKSASGCVLVVEDPFIRRFVGGVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPAHFCEFAETLPLIYVATFPDPELADRFRCCRTLHKPFRPSDLAACAAELAPTEDV*
Ga0116121_100592243300009644PeatlandVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGELALCAAELAPLARV*
Ga0116106_108546913300009645PeatlandQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV*
Ga0116132_121561813300009646PeatlandMQQKAALGCALIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV*
Ga0116130_100439743300009762PeatlandVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV*
Ga0116130_100761423300009762PeatlandMQQKAALGCALIVEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDSALADRFRRCRALRKPFRPSDLVLCAAELAPPVLV*
Ga0116134_117626713300009764PeatlandPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGELALCAAELAPLARV*
Ga0116219_1073424713300009824Peatlands SoilMPSKTAPGYVLVVEDPAIRRFVGGILKRHGHLVVEAELEEAQRTLRHDEGAVALLITNVPTYFLEFAETVPLIYIAAFPDPALARRFRRCHMLHKPFNPSDLVANAAELAPLENS*
Ga0116223_1010676223300009839Peatlands SoilMPQKTAARCVLVVEDPLIQRFVGGLLKREGRQVVESELEGALNTLRHDSGTVSLLITNAPAHFLEFAETVRIIYMAAFPDPELAGRFRSCRTLRKPFRPSELVATAAELAPLENF*
Ga0074046_1029067313300010339Bog Forest SoilVLIAEDPLICRFIGGILKREGYVVVETEPEAALRILRAGDGTVSLLITNQPARFLEFAETIPLIYIAAFPDPKLADRFLRCLMLRKPFPPGELLALAAELAPPERR*
Ga0136449_10014393733300010379Peatlands SoilMPQKTAARCVLVVEDPLIQRFVGGLLKREGRKVVESELEGALNTLRHDSGTVSLLITNAPAHFLEFAETVRIIYMAAFPDPELAGRFRSCRTLRKPFRPSELVATAAELAPLENF*
Ga0136449_10032026823300010379Peatlands SoilMHPAKAPGCVLIVEDPLIRRFVRGILKRDGRVAVEVEQDEALRILRAGDRTISLLITNRPASFLEFSDALPLLYIAASPDPALAARFRYCRMLRKPFSFGDLLECAAALNSPG*
Ga0136449_10147872423300010379Peatlands SoilMMRQEAASRSALIVEDPMIRRFVGGILRREGHAVVEAELGEALQTLRDRPGAISVLITNVPAHFLEFAEALPLIYVATSPDPALAVRFRRCRTLRKPFRPTELVLCAA
Ga0136449_10327038223300010379Peatlands SoilMPVAPSPIGQEKQEKTARGRVLIVEDAMIRRFVAGILRRDGYAVVETERAAALRTLRQSPGAVSLLITNGPADFLEFADTVPLIYVAAFPDPELAHRFRSCRMLRKPFRPEELASYAAELSPPAAA*
Ga0136449_10415526013300010379Peatlands SoilMPQLTASGSALIVEDPMIRRFVGGILKREGHAVVEAELGEALRTLREAPGVVSLLITNVPAHFLEFAETLPLIYVATSPDPKLADRFHRCRTLRKPFRPGDLVSYAAELAPRARA*
Ga0181527_100902643300014153BogMQQKAALGCALIVDDPIIRRFVGGILKREGYTVAEAELEEALRTLRDAPGAVSLLITNGPAHFLEFAESLPLIYVAAFPDPALASRFRHCRTLRKPFCPGDLVLCAAELAQAVAV*
Ga0181518_1011684723300014156BogMQQKAALGCALIVEDPMIQRFVGGILKREGYLVVKAELHEALRTLRDSPDLVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADRFRRCRALRKPFHPSDLALCAAELSPAVPAV*
Ga0181518_1014419423300014156BogMQEKDALGCALIVEDPMIRRLVGGILKREGYAVIEAELEEALRTLRDAPGTVSLLVTNVPGDFFEFAETLPVIYVAAFPDPALAGRFRHCRALRKPFRPGDLALCAAELAPPVLTV*
Ga0181517_1000633963300014160BogMIQRFVGGVLKREGYDVAEAELEEALLALRAGSGAVSLLITNRPASFLEFAETLPLVYVAAFPDPALTARFRRCRVLRKPFDPGDLAQCAAELAGPVAV*
Ga0181517_1001077653300014160BogMPQKTALGCALIVEDPMIQRFVGGILKRERYAAVETGLEQALLTLRDAPESVSLLITNVPAHFLEFAETVPLIYVATSPDPALANRFRCCRTLRKPFRPGDLASCAAELAPRSDV*
Ga0181529_10000256213300014161BogMQPRTPGGYVLVVEDPFICRFVGGILKRAGRLAFEAEHEQAVRMLRDADWVVSLLITNQPARFLEFADTVPLIYIAAFPDPALANRFRHCRMLCKPFLPAELIECAAELAPPEKPS*
Ga0181532_1026647023300014164BogMIRRFVGGILRRAGYSVVEAGLDEALRTLRDSPGAVSLLITNVPAQFLEFAETLPLIYDAAFPDPALASRFRYCRTLRKPFLPADLASLAAELAPSTDV*
Ga0181528_1024221623300014167BogMQAKTGPGLVLIVEDPLIQRFVGGILKREVRPVVEASVDGALRILGAGDPAVALLITNQPARFLEFAETLPLLYIAAFPDPALAERFHRCRMLRKPFPPMDLMACAAELAPPNPAAV*
Ga0181535_10009756113300014199BogMPEKIPPGCVLVVEDPLIRKFVSGILKREGHSVVEAGLEEAQRTLRSHSAVSLLITNVPAYFLEFAETVPLIYMASSPDPALAGQFRSCRTLGKPFLASDLAADAAELTQQSA*
Ga0181535_1030571923300014199BogRFVGGILKRERYAAVETGLEQALLTLRDAPESVSLLITNVPAHFLEFAETVPLIYVATSPDPALANRFRCCRTLRKPFRPGDLASCAAELAPRSDV*
Ga0181526_1007562313300014200BogCALIVEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADGFRRCRVLRKPFRPSDLALCAAELAPPVLTF*
Ga0182014_1033296213300014491BogYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV*
Ga0182014_1033500013300014491BogYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV*
Ga0182013_1005520143300014492BogVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV*
Ga0182011_1075896623300014496FenLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV*
Ga0181536_1004950943300014638BogVEDPMIQRFVGGILKREGYLVVKAELHEALRTLRDSPDLVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADRFRRCRALRKPFHPSDLALCAAELSPAVPAV*
Ga0182027_1021289123300014839FenVLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGHFVEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV*
Ga0181505_1085919313300016750PeatlandMQPTTARGCVLIVEDPRVRRLIAGILKRERYAVVEAELEEALRILREAPDGVALLITNVPAHFCEFAETLPLVYVAAFPDPALADRFRRCRTLCKPFRPCELNQCAAELVAPADV
Ga0187856_1000650193300017925PeatlandMPEKSASGCVLVVEDPFIRRFVGGVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPAHFCEFAETLPLIYVATFPDPELADRFRCCRTLHKPFRPSDLAACAAELAPTEDV
Ga0187856_105333813300017925PeatlandMQQKAALGCALIVEDPIIRRFVGGILKREGYTVAEAELEEALRTLRDAPGAVSLLITNGPAHFLEFAESLPLIYVAAFPDPALASRFRHCRTLRKPFCPGDLVLCAAELAQAVAV
Ga0187877_109161513300017931PeatlandMKQPTASGCVLIVEDPLIRRFVGGILKREGHPVAESGLEDALQTLRDAPGAVSLLITNAPAPFLEFAETLPLIYIASSPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0187848_1012116523300017935PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0187854_1042043923300017938PeatlandEHVLCAFAGRTMMKQPTASGCVLIVEDPLIRRFVGGILKREGHPVAESGLEDALQTLRDAPGAVSLLITNAPAPFLEFAETLPLIYIASSPDPALADRFHHHRTLRKPFRPADLVLCAAELAPLAEVHPVR
Ga0187850_1013258723300017941PeatlandFVGGILKREGYTVAEAELEEALRTLRDAPGAVSLLITNGPAHFLEFAESLPLIYVAAFPDPALASRFRHCRTLRKPFCPGDLVLCAAELAQAVAV
Ga0187879_1001205323300017946PeatlandMQSTTASGCVLIVEDPMIQRFVGGVLKREGYDVAEAELEEALLALRAGSGAVSLLITNRPASFLEFAETLPLVYVAAFPDPALTARFRRCRVLRKPFDPGDLAQCAAELAGPVAV
Ga0187879_1007186123300017946PeatlandVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGELALCAAELAPLARV
Ga0187879_1022702023300017946PeatlandMPQKAAVGCALIVEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADGFRRCRVLRKPFRPSDLALCAAELAPPVLTF
Ga0187847_100000171453300017948PeatlandMIQRFVGGVLKREGYDVAEAELEEALLALRAGSGAVSLLITNRPASFLEFAETLPLVYVAAFPDPALTARFRRCRVLRKPFDPGDLAQCAAELAGPVAV
Ga0187847_1011581823300017948PeatlandMPEKIPPGCVLVVEDPLIRKFVSGILKREGHSVVEAGLEEAQRTLRSHSAVSLLITNVPAYFLEFAETVPLIYMASSPDPALAGQFRSCRTLGKPFLASDLAADAAELTQQSA
Ga0181520_1002915043300017988BogMQPRTPGGYVLVVEDPFICRFVGGILKRAGRLAFEAEHEQAVRMLRDADWVVSLLITNQPARFLEFADTVPLIYIAAFPDPALANRFRHCRMLCKPFLPAELIECAAELAPPEKPS
Ga0181520_1004309123300017988BogMPQKTALGCALIVEDPMIQRFVGGILKRERYAAVETGLEQALLTLRDAPESVSLLITNVPAHFLEFAETVPLIYVATSPDPALANRFRCCRTLRKPFRPGDLASCAAELAPRSDV
Ga0181520_1044445523300017988BogEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADGFRRCRVLRKPFRPSDLALCAAELAPPVLTF
Ga0187873_122966723300018013PeatlandGILKREGYTVAEAELEEALRTLRDAPGAVSLLITNGPAHFLEFAESLPLIYVAAIPDPALASRFRHCRTLRKPFCPGDLVLCAAELAQAVAV
Ga0187880_105453723300018016PeatlandMMKQPTASGCVLIVEDPLIRRFVGGILKREGHPVAESGLEDALQTLRDAPGAVSLLITNAPAPFLEFAETLPLIYIASSPDPALADRFHHHRTLRKPFRPADLVLCAAELAPLAEVHPVR
Ga0187880_121481023300018016PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPPVLV
Ga0187886_119099113300018018PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPL
Ga0187874_1015432723300018019PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFRPSDLVLCAAELAAPALTV
Ga0187861_1002029443300018020PeatlandMKQPTASGCVLIVEDPLIRRFVGGILKREGHPVAESGLEDALQTLRDAPGAVSLLITNAPAPFLEFAETLPLIYIASSPDPALADRFHHHRTLRKPFRPADLVLCAAELAPLAEVHPVR
Ga0187864_1001158843300018022PeatlandMQQKAALGCALVVEDPIIRRFVGGILKREGYTVAEAELEEALRTLRDAPGAVSLLITNGPAHFLEFAESLPLIYVAAFPDPALASRFRHCRTLRKPFCPGDLVLCAAELAQAVAV
Ga0187881_1026364723300018024PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILEREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0187857_1013039413300018026PeatlandALIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGELALCAAELAPLARV
Ga0187867_1004938733300018033PeatlandCALIVEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADGFRRCRVLRKPFRPSDLALCAAELAPPVLTF
Ga0187867_1020723323300018033PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGELALCAAELAPLARV
Ga0187875_1004292723300018035PeatlandVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0187871_1001386173300018042PeatlandMPEKIPPGCVLVVEDPLIRKFVSGILKREGHSVVEAGLEEAQRTLRSHSAVSLLITNVPAYFLEFAETVPLIYMASSPDPALAGQFRSCRTLGKPFLASDLAA
Ga0187871_1017975213300018042PeatlandVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGELALCAAEPAPLARV
Ga0187887_1001263363300018043PeatlandMQQKAALGCALIVEDPMIQRFVGGILKREGYLVIEAELEEALRTLRDSPDAVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADGFRRCRVLRKPFRPSDLALCAAELAPPVLTF
Ga0187890_1040223713300018044PeatlandMQAKTGPGLVLIVEDPLIQRFVGGILKREGRPVVEASVDGALRILGAGDPAVALLITNQPARFLEFAETLPLLYIAAFPDPALAERFHRCRMLRKPFPPMDLMACAAELAPPNPAAV
Ga0187765_1019520923300018060Tropical PeatlandMADKSPDDCVLVVEDPLIRRFVRSLLEREGRVAVEAETDQALRTLRTNQGTVCLLITNSPGEFLEFAETLPVIYVATFPDPALAGRFRNCRTLRKPFRPRDLLTCAAELAPPHCA
Ga0182028_130594223300019788FenMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFSNSQKHIPSFTCGVSGSALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0182028_153769433300019788FenVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGHFVEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0224534_100006963300022524SoilVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0224554_101577413300023068SoilGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGHFVEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0224535_100242453300023258SoilMQLKTGHGFVLIVEDPLIQRFVGGILKRGGRPVVEADGDGALRILRAGDSAVALLITNKPARFLEFAGTLPLLYIAAFPDPALADRFRRCRMLRKPFAPVDLMACAAELAPPGPASG
Ga0208034_102552313300025442PeatlandVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPAHFCEFAETLPLIYVATFPDPELADRFRCCRTLHKPFRPSDLAACAAELAPTEDV
Ga0208189_102584523300025444PeatlandMQQKAALGCALIVEDPIIRRFVGGILKREGHPVAESGLEDALQTLRDAPGAVSLLITNAPAPFLEFAETLPLIYIASSPDPALADRFHHHRTLRKPFRPADLVLCAAELAPLAEVHPVR
Ga0208191_110804223300025496PeatlandMCAFDDRIIMPEKSASGCVLVVEDPFIRRFVGGVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPAHFCEFAETLPLIYVATFPDPELADRFRCCRTLHKPFRPSDLAACAAELAPTEDV
Ga0208686_107051823300025500PeatlandMCAFDDRIIMPEKSASGCVLVVEDPFIRRFVGGVLKREGYLVVEAELAEALRTLRDQPGTVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0209517_1068155213300027854Peatlands SoilWLALSRAQNSKGNLHREFASLPLRQQMPQKTAARCVLVVEDPLIQRFVGGLLKREGRKVVESELEGALNTLRHDSGTVSLLITNAPAHFLEFAETVRIIYMAAFPDPELAGRFRSCRTLRKPFRPSELVATAAELAPLENF
Ga0209415_1003650683300027905Peatlands SoilMPSKTAPGYVLVVEDPAIRRFVGGILKRHGHLVVEAELEEAQRTLRHDEGAVALLITNVPTYFLEFAETVPLIYIAAFPDPALARRFRRCHMLHKPFNPSDLVANAAELAPLENS
Ga0209415_1041177123300027905Peatlands SoilMHPAKAPGCVLIVEDPLIRRFVRGILKRDGRVAVEVEQDEALRILRAGDRTISLLITNRPASFLEFSDALPLLYIAASPDPALAARFRYCRMLRKPFSFGDLLECAAALNSPG
Ga0302153_1017061123300028574BogRPSVGIVGFLWPCAEWYLEPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0302267_1028066823300028745BogVGIVGFLWPCAEWYLEPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0302156_1001653453300028748BogVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAADL
Ga0265338_1073215413300028800RhizosphereMQETAHGCALVVEDPMIRRFVGSILKREGYLVVEAGLEEALRTLRDEPSAVSLLITNAPGSFGEFAETLPLLYVASSPDPVLAGRFRRCRTLRKPFSPRDLTVCAAELAPPLSA
Ga0311329_1011349343300029907BogEWYLEPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0311361_10001214453300029911BogVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0302185_1028451913300030508BogVRPAGNSITAPLGVTARPSVGIVGFLWPCAEWYLEPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0302275_1063395913300030518BogPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0265331_1005522723300031250RhizosphereMQETAHGCALVVEDPMIRRFVGSILKREGYLVVEAGLEEALRTLRDEPSAVSLLITNAPGSFGEFAETLPLLYVASSPDPVLAGRFRRCRTLRKPFRPRDLTVCAAELAPPLSA
Ga0302187_1007553533300031259BogGNSITAPLGVTARPSVGIVGFLWPCAEWYLEPQYAFCACAEGSIVPQTTAPGPVLIVEDPMIRKFVGGILKREGYVVIEAELEEALRTLRDAPDAVSLLITNVPGHFFEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0311301_1167624623300032160Peatlands SoilVFCTVADGTMMRQEAASRSALIVEDPMIRRFVGGILRREGHAVVEAELGEALQTLRDRPGAISVLITNVPAHFLEFAEALPLIYVATSPDPALAVRFRRCRTLRKPFRPTELVLCAA
Ga0311301_1224605713300032160Peatlands SoilMPVAPSPIGQEKQEKTARGRVLIVEDAMIRRFVAGILRRDGYAVVETERAAALRTLRQSPGAVSLLITNGPADFLEFADTVPLIYVAAFPDPELAHRFRSCRMLRKPFRPEELASYAAELSPPAAA
Ga0335078_1026698333300032805SoilMPQENTPRAALIVEDPLIRKFVGDILKRKGFAVVEAELDEALRRLRDAPEAVSLLVTNVPAHFLEFAETLPVLYDAAFPDPALAARFRRCRTLRKPFHPGDLAECATELARPKAG
Ga0335078_1058849323300032805SoilMPQEKSPAAALIVEDPLIRKFVGGILKSKGFAVVEAELDEALRTLRDTPDAVSLLVTNAPAHFLEFAETLPVLYDAAFPDPALAARFRRCLTLRKPFHPCDLAARAVELAQPEQE
Ga0335078_1130602023300032805SoilGCALVVEDPLIGRFVACVLKREGYSVIEAQLEEALRTLRENPAAVSLLVTNQPHYFIDFANTLPLIYDAAFPDPELAQRFSCCRTLRKPFRPCELVSCADELAGREPRLTRQ
Ga0326728_10013398123300033402Peat SoilMQQKAALGCALIVEDPMIQRFVGGILKREGYLVVKAELHEALRTLRDSPDLVSLLITNVPGHFFEFAETLPLIYVAAFPDPALADRFRRCRALRKPFHPSDLALCAAELSPAVPAV
Ga0326727_1099062013300033405Peat SoilMQAKTGPGLVLIVEDPLIQRFVGGILKREGRPVVEASVDGALRILGAGDPAVALLITNQPACFLEFAETLPLLYIAAFPDPALAERFHRCRMLRKPFPPMDLMACAAELAPPNPAAV
Ga0334804_042818_753_10733300033818SoilVLIVEDPMIRKFVGGILKREGYVVIEAELKEALRTLRDAPDAVSLLITNVPGHFVEFAETHPLIYVAAFPDSALADRFRRCRALRKPFHPGDLALCAAELVPLARV
Ga0334837_085475_366_6653300033823SoilMIRKFVGGILKREGYVVIEAELEAALRTLRGAPDAVSLLITNVPGNFLEFAETHPLIYVAAFPDPALADRFRRCRALRKPFHPGDLALCAAELAPLARV
Ga0314861_0073148_17_3643300033977PeatlandMPQESTPKAALIVEDPLIRKLVGGILKREGFAVVEAEVDEALRTLRAVPGAFSLLVTNVPAHFLEFAETLPLIYDAAFPDPALAARFRRCRTLRKPFHPDELAACAAELAKPEQG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.