| Basic Information | |
|---|---|
| Family ID | F100024 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.38 % |
| % of genes near scaffold ends (potentially truncated) | 18.45 % |
| % of genes from short scaffolds (< 2000 bps) | 82.52 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.641 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.359 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.155 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (30.097 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13560 | HTH_31 | 43.69 |
| PF00892 | EamA | 27.18 |
| PF01546 | Peptidase_M20 | 6.80 |
| PF13561 | adh_short_C2 | 2.91 |
| PF11272 | DUF3072 | 2.91 |
| PF01381 | HTH_3 | 1.94 |
| PF04107 | GCS2 | 1.94 |
| PF00459 | Inositol_P | 1.94 |
| PF00106 | adh_short | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF03992 | ABM | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.64 % |
| Unclassified | root | N/A | 21.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0652520 | Not Available | 525 | Open in IMG/M |
| 3300000550|F24TB_10014311 | Not Available | 520 | Open in IMG/M |
| 3300000550|F24TB_10601476 | Not Available | 652 | Open in IMG/M |
| 3300000891|JGI10214J12806_11870982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
| 3300000956|JGI10216J12902_102621188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300001431|F14TB_100656225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300003373|JGI25407J50210_10011361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2275 | Open in IMG/M |
| 3300003373|JGI25407J50210_10021395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1682 | Open in IMG/M |
| 3300003373|JGI25407J50210_10090934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300003373|JGI25407J50210_10114005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300004016|Ga0058689_10044596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300004016|Ga0058689_10155905 | Not Available | 530 | Open in IMG/M |
| 3300004157|Ga0062590_101567264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300005562|Ga0058697_10097526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
| 3300005562|Ga0058697_10733789 | Not Available | 528 | Open in IMG/M |
| 3300005562|Ga0058697_10796882 | Not Available | 510 | Open in IMG/M |
| 3300005981|Ga0081538_10007532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9407 | Open in IMG/M |
| 3300005981|Ga0081538_10049121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2563 | Open in IMG/M |
| 3300005985|Ga0081539_10038370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2840 | Open in IMG/M |
| 3300006049|Ga0075417_10001346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 6715 | Open in IMG/M |
| 3300006844|Ga0075428_100985805 | Not Available | 892 | Open in IMG/M |
| 3300006845|Ga0075421_100256552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2142 | Open in IMG/M |
| 3300006847|Ga0075431_100614240 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300006852|Ga0075433_10624209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 945 | Open in IMG/M |
| 3300009789|Ga0126307_10262060 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300009817|Ga0105062_1066032 | Not Available | 680 | Open in IMG/M |
| 3300009840|Ga0126313_10074306 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
| 3300010038|Ga0126315_10032198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2735 | Open in IMG/M |
| 3300010038|Ga0126315_10052305 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300010041|Ga0126312_10159249 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300010041|Ga0126312_10180471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1472 | Open in IMG/M |
| 3300010042|Ga0126314_10406558 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300010044|Ga0126310_10698531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
| 3300010145|Ga0126321_1344920 | Not Available | 521 | Open in IMG/M |
| 3300010395|Ga0058701_10772188 | Not Available | 525 | Open in IMG/M |
| 3300010999|Ga0138505_100010126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300011000|Ga0138513_100015499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300012939|Ga0162650_100017749 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012941|Ga0162652_100058368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300014487|Ga0182000_10357944 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300014487|Ga0182000_10537991 | Not Available | 551 | Open in IMG/M |
| 3300014487|Ga0182000_10598675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300015077|Ga0173483_10910459 | Not Available | 519 | Open in IMG/M |
| 3300017965|Ga0190266_10050285 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300017965|Ga0190266_10167012 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300018027|Ga0184605_10125153 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300018056|Ga0184623_10093579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1387 | Open in IMG/M |
| 3300018066|Ga0184617_1215274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300018072|Ga0184635_10043081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1729 | Open in IMG/M |
| 3300018073|Ga0184624_10129614 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300018074|Ga0184640_10073655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1450 | Open in IMG/M |
| 3300018075|Ga0184632_10018833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2916 | Open in IMG/M |
| 3300018076|Ga0184609_10002100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6489 | Open in IMG/M |
| 3300018076|Ga0184609_10089102 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300018465|Ga0190269_10117144 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300018466|Ga0190268_10109824 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300018466|Ga0190268_11867101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300018476|Ga0190274_12034164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300019377|Ga0190264_11009094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300019869|Ga0193705_1091430 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300020005|Ga0193697_1031685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1321 | Open in IMG/M |
| 3300022756|Ga0222622_10009435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4570 | Open in IMG/M |
| 3300026670|Ga0208216_102291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300026672|Ga0208214_104138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300027750|Ga0209461_10143676 | Not Available | 576 | Open in IMG/M |
| 3300027750|Ga0209461_10156249 | Not Available | 558 | Open in IMG/M |
| 3300027873|Ga0209814_10000488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13066 | Open in IMG/M |
| 3300027907|Ga0207428_10143176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1823 | Open in IMG/M |
| 3300028589|Ga0247818_10269963 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300028707|Ga0307291_1017693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1598 | Open in IMG/M |
| 3300028712|Ga0307285_10003942 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300028720|Ga0307317_10003860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4503 | Open in IMG/M |
| 3300028720|Ga0307317_10041089 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300028722|Ga0307319_10043203 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300028787|Ga0307323_10003941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4812 | Open in IMG/M |
| 3300028796|Ga0307287_10121656 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300028811|Ga0307292_10004633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4643 | Open in IMG/M |
| 3300028828|Ga0307312_10276788 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300028878|Ga0307278_10328094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300028880|Ga0307300_10334245 | Not Available | 519 | Open in IMG/M |
| 3300030496|Ga0268240_10183720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300030499|Ga0268259_10048324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 863 | Open in IMG/M |
| 3300030499|Ga0268259_10057886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300030510|Ga0268243_1089172 | Not Available | 707 | Open in IMG/M |
| 3300030511|Ga0268241_10073604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300030514|Ga0268253_10014431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1824 | Open in IMG/M |
| 3300030514|Ga0268253_10304542 | Not Available | 553 | Open in IMG/M |
| 3300030516|Ga0268255_10055985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1254 | Open in IMG/M |
| 3300031091|Ga0308201_10020351 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300031731|Ga0307405_10262836 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300031901|Ga0307406_10161680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1610 | Open in IMG/M |
| 3300031903|Ga0307407_11245438 | Not Available | 582 | Open in IMG/M |
| 3300031995|Ga0307409_100157262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1982 | Open in IMG/M |
| 3300031995|Ga0307409_101084557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300031995|Ga0307409_101229108 | Not Available | 773 | Open in IMG/M |
| 3300032002|Ga0307416_100714375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
| 3300032004|Ga0307414_11186838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300032004|Ga0307414_11272828 | Not Available | 682 | Open in IMG/M |
| 3300032159|Ga0268251_10031115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catenuloplanes → Catenuloplanes japonicus | 1655 | Open in IMG/M |
| 3300032159|Ga0268251_10038029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catenuloplanes → Catenuloplanes japonicus | 1527 | Open in IMG/M |
| 3300032159|Ga0268251_10600792 | Not Available | 506 | Open in IMG/M |
| 3300034172|Ga0334913_135956 | Not Available | 524 | Open in IMG/M |
| 3300034174|Ga0334932_001195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4069 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.36% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 9.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 8.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 5.83% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.91% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026670 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1111 (SPAdes) | Environmental | Open in IMG/M |
| 3300026672 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_06525202 | 3300000033 | Soil | MELIWLVLTLVVLDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG* |
| F24TB_100143112 | 3300000550 | Soil | MELIWLVLTLIAVDLAALRFSXDTRPGLQHSSRHRLRRRSATG* |
| F24TB_106014762 | 3300000550 | Soil | MALFWLVLALLVVDLAAFLFGADTRPGFQHSSHRRANGG* |
| JGI10214J12806_118709824 | 3300000891 | Soil | MELIWLVLTLVVVDLAAVLFAVDTRPGLQHTSRWHPGRRTLTG* |
| JGI10216J12902_1026211881 | 3300000956 | Soil | PVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG* |
| F14TB_1006562252 | 3300001431 | Soil | MELIWLVLTLIAVDLAALRFAADTRPGLQHSSRHRLRRRSATG* |
| JGI25407J50210_100113614 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MELIWLVLVLLAVDLAAFVFAADTRPGLQHTSRWRDRHRATTG* |
| JGI25407J50210_100213952 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MELLWIVLSVVVLDLAAYLFAADSRPGLQHTSHWPTGRRTRTG* |
| JGI25407J50210_100909342 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MELLWFVLILLAVDLAAFRFAADTRPGLEHSAHWPSRRSTRG* |
| JGI25407J50210_101140052 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MELVWLVLTLLAVDLAAVLFAADTRPGLQHTSRWRRRRPSTG* |
| Ga0058689_100445962 | 3300004016 | Agave | MELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG* |
| Ga0058689_101559051 | 3300004016 | Agave | MELLWIVLSLIVVDLAAFLFAADTRPGLERTSRWHDRRRSIAG* |
| Ga0062590_1015672642 | 3300004157 | Soil | MELLWLVLSLIVLDLAAFLFAVDTRPGLQHTSRRRDRRPDRPRSATS* |
| Ga0058697_100975263 | 3300005562 | Agave | MELLWIVLSLLVVDLAAFLFAADTRPGLEHSSRRRDRRRSIAG* |
| Ga0058697_107337891 | 3300005562 | Agave | LVGPVKNRGAIMELLLLVLSLVVVDLAALLFAVDTRPGLQHTSRWHALRRSTTG* |
| Ga0058697_107968822 | 3300005562 | Agave | MELLLLVLSLVVVDLAALLFAVDTRPGLQHTSRWHALRRSTTG* |
| Ga0081538_100075329 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MEVIWLVLVLLAVDLAAFLFSADTRPGLQHTPRWRDRHRAATG* |
| Ga0081538_100491213 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MELIWLVLVLLAVDLAAFLFAADTRPGLQHTSRWRDRHRATTG* |
| Ga0081539_100383702 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MELIWIVLTLLVLDLAAFLFAADTRPGLQHTSRWRGR* |
| Ga0075417_100013465 | 3300006049 | Populus Rhizosphere | MELIWLVLSLLVLDLAAFLFAVDTRPGLRHTSRWRDRRRSITG* |
| Ga0075428_1009858052 | 3300006844 | Populus Rhizosphere | MELIWLVLSLIVVDLAAFLFAADTRPGLQHTSRWRDRPPSIT |
| Ga0075421_1002565522 | 3300006845 | Populus Rhizosphere | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRHRFRRRSATG* |
| Ga0075431_1006142401 | 3300006847 | Populus Rhizosphere | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRRFRRRSATG* |
| Ga0075433_106242092 | 3300006852 | Populus Rhizosphere | MELIWLVLSLIVVDLAAFLFAADTRPGLQHTSRWRDRPPSITG* |
| Ga0126307_102620602 | 3300009789 | Serpentine Soil | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTG* |
| Ga0105062_10660322 | 3300009817 | Groundwater Sand | MGLIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS* |
| Ga0126313_100743062 | 3300009840 | Serpentine Soil | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTS* |
| Ga0126315_100321984 | 3300010038 | Serpentine Soil | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWHDRRHDRRRSVTG* |
| Ga0126315_100523052 | 3300010038 | Serpentine Soil | MELLWLVLSLLVIDVAAFLFAVDTRPGLEHTSRWRDRRRSIAG* |
| Ga0126312_101592491 | 3300010041 | Serpentine Soil | SLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTG* |
| Ga0126312_101804711 | 3300010041 | Serpentine Soil | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRRRSVTG* |
| Ga0126314_104065582 | 3300010042 | Serpentine Soil | MELIWFVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG* |
| Ga0126310_106985312 | 3300010044 | Serpentine Soil | MELLWLVLSLIVVDLAAFLFAVDTRPGLEHTSRWRDRRRSIAG* |
| Ga0126321_13449202 | 3300010145 | Soil | MELIWIVLSLLVLDLAAFLFAADTRPGLQHTSRWHDRRRSITG* |
| Ga0058701_107721882 | 3300010395 | Agave | MEVIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG* |
| Ga0138505_1000101262 | 3300010999 | Soil | MELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG* |
| Ga0138513_1000154992 | 3300011000 | Soil | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRRSVTG* |
| Ga0162650_1000177491 | 3300012939 | Soil | MELVWLVLTLIVVDLAALRFAADTRPGLQHSSRHRLRRRSATG* |
| Ga0162652_1000583681 | 3300012941 | Soil | MELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLT |
| Ga0182000_103579442 | 3300014487 | Soil | MELLWLVLSLLVVDLAAFLFAADTRPGLEHSSRRRDRRRSIAG* |
| Ga0182000_105379912 | 3300014487 | Soil | MELFWLVLLLVVLDLASFVFAIDSRPGLQHTSRWRSRRSING* |
| Ga0182000_105986752 | 3300014487 | Soil | MELIWLVLILLVVDLAAFLFAADTRPGLQYSSRRHAPRSHAP |
| Ga0173483_109104592 | 3300015077 | Soil | MELLWLVLSLIVLDLAAFLFAVDTRPGLQHTSRRRDRRPDRPRSATG* |
| Ga0190266_100502852 | 3300017965 | Soil | MELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG |
| Ga0190266_101670121 | 3300017965 | Soil | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRLRLRRRSATG |
| Ga0184605_101251532 | 3300018027 | Groundwater Sediment | MELIWLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0184623_100935793 | 3300018056 | Groundwater Sediment | MGLIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS |
| Ga0184617_12152741 | 3300018066 | Groundwater Sediment | MALFWLVLALLVVDLAAFLFGADTRPGFQHSSHRRANGG |
| Ga0184635_100430812 | 3300018072 | Groundwater Sediment | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRRLRRRSATG |
| Ga0184624_101296141 | 3300018073 | Groundwater Sediment | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRLRRRSATG |
| Ga0184640_100736553 | 3300018074 | Groundwater Sediment | MELLWLVLSLLAVDLAALLFAADTRPGLQHSSRHRLRRRSATG |
| Ga0184632_100188331 | 3300018075 | Groundwater Sediment | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRHRFRRRSATG |
| Ga0184609_100021001 | 3300018076 | Groundwater Sediment | MELIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS |
| Ga0184609_100891023 | 3300018076 | Groundwater Sediment | MGLIWVMLSLLVVDVAALLFAADTRPGLQHSARWWNRRPTS |
| Ga0190269_101171441 | 3300018465 | Soil | MELVWLVLTLIVVDVAALRFAADTRPGFQHSSRRLRRRSATG |
| Ga0190268_101098242 | 3300018466 | Soil | MELVWLVLTLIVVDLAALRFAADTRPGLQHSSRHRLRRRSATG |
| Ga0190268_118671012 | 3300018466 | Soil | MELLWLVLSLIVVDLAAFRFAADSRPGLQHSSRHRLRRRSATG |
| Ga0190274_120341641 | 3300018476 | Soil | MELIWLVLTLVAVDLAAFLFAADTRPGLQHSSRLRLRRRSATG |
| Ga0190264_110090942 | 3300019377 | Soil | MELLWLTIALIVVVDLAAVLFAADTRPGLEHSARWWNRR |
| Ga0193705_10914302 | 3300019869 | Soil | MELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSIPG |
| Ga0193697_10316852 | 3300020005 | Soil | MELLWLVLSLLAVDLAALLFAADTRPGLQHSSRHRFRRRSATG |
| Ga0222622_100094355 | 3300022756 | Groundwater Sediment | MELIWLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSIPG |
| Ga0208216_1022912 | 3300026670 | Soil | MELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG |
| Ga0208214_1041382 | 3300026672 | Soil | GPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG |
| Ga0209461_101436762 | 3300027750 | Agave | MVLLWLVLSLIVLDLAPLVFAVDTRPGLRHTSRWHDGRRWPDRRRSLTG |
| Ga0209461_101562492 | 3300027750 | Agave | MELLWIVLSLLVVDLTAILFAVDTRPGLEHSSRWRDRRRSIAG |
| Ga0209814_100004889 | 3300027873 | Populus Rhizosphere | MELIWLVLSLLVLDLAAFLFAVDTRPGLRHTSRWRDRRRSITG |
| Ga0207428_101431762 | 3300027907 | Populus Rhizosphere | MELIWLVLSLIVVDLAAFLFAADTRPGLQHTSRWRDRPPSITG |
| Ga0247818_102699631 | 3300028589 | Soil | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRRRFRRRSATG |
| Ga0307291_10176934 | 3300028707 | Soil | MELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0307285_100039423 | 3300028712 | Soil | MELIWLVLSLLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0307317_100038601 | 3300028720 | Soil | VLSVLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0307317_100410891 | 3300028720 | Soil | LTLIAVDLAALRFAADTRPGLQHSSRHRFRRRSATG |
| Ga0307319_100432031 | 3300028722 | Soil | MELVWLVLTLIAVDLAALRFAADTRPGLQHSSRHRLRRRSATG |
| Ga0307323_100039411 | 3300028787 | Soil | RTRERPMELIRLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0307287_101216561 | 3300028796 | Soil | MELIWLVLSVLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0307292_100046331 | 3300028811 | Soil | MELIWLVLSVLVLDLAAFLFAVDTRPGLQHTSRWRGRRRSIPG |
| Ga0307312_102767883 | 3300028828 | Soil | MELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRGRRR |
| Ga0307278_103280941 | 3300028878 | Soil | WEPPMGLIWVMLSLLVVDLAALLFAADTRPGLQHSARWWNRRPTS |
| Ga0307300_103342452 | 3300028880 | Soil | MELMWLVLSVLVVDLAAFLFAVDTRPGLQHTSRWRGRRRSITG |
| Ga0268240_101837201 | 3300030496 | Soil | MELLWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWHDRRRSTAG |
| Ga0268259_100483241 | 3300030499 | Agave | GPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG |
| Ga0268259_100578861 | 3300030499 | Agave | MELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWRGRRSIAG |
| Ga0268243_10891722 | 3300030510 | Soil | MELLLLVLSLVVVDLAALLFAVDTRPGLQHTSRWHALRRSTTG |
| Ga0268241_100736042 | 3300030511 | Soil | MELLWIVLSVIVVDLAAFLFAADTRPGLERTSRWHDRRRSITG |
| Ga0268253_100144314 | 3300030514 | Agave | MELLWIVLSLIVVDLAAFLFAADTRPGLERTSRWHDRRRSLTG |
| Ga0268253_103045422 | 3300030514 | Agave | TGTSLVGPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG |
| Ga0268255_100559852 | 3300030516 | Agave | MEVLWIVLSLIVVDLAAFLFAVDTRPGLEHSSRWRDRRRSIAG |
| Ga0308201_100203512 | 3300031091 | Soil | MELIWLVLSLLVVDLAAFLFAVDTRPGLQHTSRWRCRRRSITG |
| Ga0307405_102628362 | 3300031731 | Rhizosphere | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRWRSVTG |
| Ga0307406_101616803 | 3300031901 | Rhizosphere | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHDRRRSVTG |
| Ga0307407_112454382 | 3300031903 | Rhizosphere | MELLWLVISLLVVDLAAFLFAVDTRPGLEHTSRWRDRRRSIAG |
| Ga0307409_1001572621 | 3300031995 | Rhizosphere | MELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRH |
| Ga0307409_1010845572 | 3300031995 | Rhizosphere | LVGPAKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRRHPGRRTLTG |
| Ga0307409_1012291081 | 3300031995 | Rhizosphere | SLIVVDLAAFLFAVDTRPGLQHTSRWRDRRHSVTG |
| Ga0307416_1007143751 | 3300032002 | Rhizosphere | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWRDRRH |
| Ga0307414_111868381 | 3300032004 | Rhizosphere | HCTGTSLVGPVKNRERSMELIWLVLTLVVVDLAAFLFAVDTRPGLQHTSRWHPGRRTLTG |
| Ga0307414_112728281 | 3300032004 | Rhizosphere | MELLWLVLSLIVVDLAAFLFAVDTRPGLQHTSRWHDRRHDRWRSVTG |
| Ga0268251_100311152 | 3300032159 | Agave | MELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWRSRRSITG |
| Ga0268251_100380294 | 3300032159 | Agave | MELLWIVLSLLVVDLAAFLFAADTRPGLEHSSRRRDRRRSIAG |
| Ga0268251_106007922 | 3300032159 | Agave | MELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWGGRRSIAG |
| Ga0334913_135956_293_421 | 3300034172 | Sub-Biocrust Soil | MELFWLVLLLVVLDLASFVFAIDTRPGLQHTSRWRTRRSITG |
| Ga0334932_001195_386_517 | 3300034174 | Sub-Biocrust Soil | MELFWIVLSVVVLDLAACLFAADSRPGLQHTSRWPTGRRTRTG |
| ⦗Top⦘ |