| Basic Information | |
|---|---|
| Family ID | F100023 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEVFGQAPATTAAH |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.88 % |
| % of genes near scaffold ends (potentially truncated) | 94.17 % |
| % of genes from short scaffolds (< 2000 bps) | 93.20 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.456 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.505 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.184 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.456 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 54.37 |
| PF00296 | Bac_luciferase | 9.71 |
| PF08241 | Methyltransf_11 | 8.74 |
| PF01261 | AP_endonuc_2 | 4.85 |
| PF13649 | Methyltransf_25 | 4.85 |
| PF13458 | Peripla_BP_6 | 1.94 |
| PF08450 | SGL | 1.94 |
| PF03972 | MmgE_PrpD | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF14903 | WG_beta_rep | 0.97 |
| PF14534 | DUF4440 | 0.97 |
| PF02653 | BPD_transp_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 9.71 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.94 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.94 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.46 % |
| All Organisms | root | All Organisms | 48.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_101090095 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1087 | Open in IMG/M |
| 3300000955|JGI1027J12803_103186016 | Not Available | 567 | Open in IMG/M |
| 3300000956|JGI10216J12902_106417273 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1035 | Open in IMG/M |
| 3300000956|JGI10216J12902_115690021 | Not Available | 531 | Open in IMG/M |
| 3300001431|F14TB_101302369 | Not Available | 556 | Open in IMG/M |
| 3300002558|JGI25385J37094_10182540 | Not Available | 562 | Open in IMG/M |
| 3300002561|JGI25384J37096_10184810 | Not Available | 623 | Open in IMG/M |
| 3300004052|Ga0055490_10213231 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300004268|Ga0066398_10028587 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005176|Ga0066679_10923457 | Not Available | 548 | Open in IMG/M |
| 3300005181|Ga0066678_10809333 | Not Available | 619 | Open in IMG/M |
| 3300005186|Ga0066676_10055868 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300005186|Ga0066676_10101238 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300005332|Ga0066388_100860675 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300005334|Ga0068869_100430892 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300005444|Ga0070694_101100327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300005445|Ga0070708_100095084 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
| 3300005445|Ga0070708_101069546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 756 | Open in IMG/M |
| 3300005451|Ga0066681_10152143 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300005471|Ga0070698_100385389 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300005536|Ga0070697_100326107 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300005540|Ga0066697_10790206 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300005552|Ga0066701_10624716 | Not Available | 653 | Open in IMG/M |
| 3300005558|Ga0066698_11002344 | Not Available | 530 | Open in IMG/M |
| 3300005586|Ga0066691_10276918 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005598|Ga0066706_10110403 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300005719|Ga0068861_102487875 | Not Available | 521 | Open in IMG/M |
| 3300005764|Ga0066903_108831002 | Not Available | 511 | Open in IMG/M |
| 3300006031|Ga0066651_10740831 | Not Available | 530 | Open in IMG/M |
| 3300006969|Ga0075419_11503335 | Not Available | 505 | Open in IMG/M |
| 3300007004|Ga0079218_10755595 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300007004|Ga0079218_13496814 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009012|Ga0066710_102304841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 783 | Open in IMG/M |
| 3300009012|Ga0066710_104473327 | Not Available | 522 | Open in IMG/M |
| 3300009088|Ga0099830_10259051 | Not Available | 1378 | Open in IMG/M |
| 3300009147|Ga0114129_11063473 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009553|Ga0105249_10950164 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300009795|Ga0105059_1003978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1247 | Open in IMG/M |
| 3300009804|Ga0105063_1020431 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 785 | Open in IMG/M |
| 3300009808|Ga0105071_1024978 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300009814|Ga0105082_1106886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300009822|Ga0105066_1063556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
| 3300010048|Ga0126373_11098126 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300010304|Ga0134088_10310730 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010335|Ga0134063_10072239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1536 | Open in IMG/M |
| 3300010335|Ga0134063_10185758 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300010335|Ga0134063_10219158 | Not Available | 899 | Open in IMG/M |
| 3300010358|Ga0126370_11647759 | Not Available | 615 | Open in IMG/M |
| 3300010359|Ga0126376_10100293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2206 | Open in IMG/M |
| 3300010359|Ga0126376_10113814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2093 | Open in IMG/M |
| 3300010359|Ga0126376_13046428 | Not Available | 518 | Open in IMG/M |
| 3300010366|Ga0126379_12237336 | Not Available | 647 | Open in IMG/M |
| 3300010397|Ga0134124_11271839 | Not Available | 758 | Open in IMG/M |
| 3300010399|Ga0134127_12027696 | Not Available | 653 | Open in IMG/M |
| 3300010403|Ga0134123_12771833 | Not Available | 558 | Open in IMG/M |
| 3300011438|Ga0137451_1155802 | Not Available | 716 | Open in IMG/M |
| 3300012208|Ga0137376_10245588 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1552 | Open in IMG/M |
| 3300012355|Ga0137369_10399058 | Not Available | 992 | Open in IMG/M |
| 3300012362|Ga0137361_10515577 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012396|Ga0134057_1156049 | Not Available | 606 | Open in IMG/M |
| 3300012519|Ga0157352_1054481 | Not Available | 605 | Open in IMG/M |
| 3300012923|Ga0137359_11242737 | Not Available | 633 | Open in IMG/M |
| 3300012960|Ga0164301_10702761 | Not Available | 761 | Open in IMG/M |
| 3300012971|Ga0126369_12295577 | Not Available | 626 | Open in IMG/M |
| 3300014862|Ga0180096_1008005 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300017654|Ga0134069_1306929 | Not Available | 564 | Open in IMG/M |
| 3300017656|Ga0134112_10396139 | Not Available | 570 | Open in IMG/M |
| 3300017656|Ga0134112_10448674 | Not Available | 540 | Open in IMG/M |
| 3300018058|Ga0187766_10441752 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300018079|Ga0184627_10493076 | Not Available | 633 | Open in IMG/M |
| 3300024330|Ga0137417_1418736 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
| 3300025905|Ga0207685_10436093 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300025922|Ga0207646_11035079 | Not Available | 724 | Open in IMG/M |
| 3300025941|Ga0207711_10987163 | Not Available | 781 | Open in IMG/M |
| 3300025971|Ga0210102_1111348 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026285|Ga0209438_1111455 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300026310|Ga0209239_1376206 | Not Available | 500 | Open in IMG/M |
| 3300026532|Ga0209160_1239465 | Not Available | 622 | Open in IMG/M |
| 3300026536|Ga0209058_1064415 | Not Available | 2000 | Open in IMG/M |
| 3300026537|Ga0209157_1070147 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027032|Ga0209877_1017583 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300027056|Ga0209879_1073948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300027169|Ga0209897_1024391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 854 | Open in IMG/M |
| 3300027821|Ga0209811_10144831 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300027862|Ga0209701_10605973 | Not Available | 580 | Open in IMG/M |
| 3300027874|Ga0209465_10125431 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300028381|Ga0268264_11312019 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300028807|Ga0307305_10437966 | Not Available | 589 | Open in IMG/M |
| 3300031549|Ga0318571_10230841 | Not Available | 673 | Open in IMG/M |
| 3300031720|Ga0307469_11242277 | Not Available | 705 | Open in IMG/M |
| 3300031720|Ga0307469_12203181 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031724|Ga0318500_10480524 | Not Available | 623 | Open in IMG/M |
| 3300031763|Ga0318537_10222914 | Not Available | 701 | Open in IMG/M |
| 3300031820|Ga0307473_10954429 | Not Available | 623 | Open in IMG/M |
| 3300031820|Ga0307473_11363632 | Not Available | 533 | Open in IMG/M |
| 3300031880|Ga0318544_10293758 | Not Available | 630 | Open in IMG/M |
| 3300032059|Ga0318533_11178271 | Not Available | 561 | Open in IMG/M |
| 3300032122|Ga0310895_10243073 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300032180|Ga0307471_102883765 | Not Available | 610 | Open in IMG/M |
| 3300032180|Ga0307471_104300407 | Not Available | 503 | Open in IMG/M |
| 3300032205|Ga0307472_101516795 | Not Available | 655 | Open in IMG/M |
| 3300032205|Ga0307472_101770399 | Not Available | 612 | Open in IMG/M |
| 3300034677|Ga0314802_045522 | Not Available | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.77% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014862 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1Da | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1010900951 | 3300000559 | Soil | DGKKLYDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAPAPTGAH* |
| JGI1027J12803_1031860162 | 3300000955 | Soil | KKLYDRKEPGAVDFLPALKEIHKIRDAIKEIFAQAPPAAAKAH* |
| JGI10216J12902_1064172731 | 3300000956 | Soil | YLDGKKLYDRKEPGAVDFLPALKEIHKIRDSIKEIFAQAPPAAAKAH* |
| JGI10216J12902_1156900211 | 3300000956 | Soil | PSDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVAPAPAAH* |
| F14TB_1013023692 | 3300001431 | Soil | PSDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAVAPAAH* |
| JGI25385J37094_101825402 | 3300002558 | Grasslands Soil | YDRKAPGAVDFLPALKEIHKIRDAIKEVFGQAPATTAAH* |
| JGI25384J37096_101848101 | 3300002561 | Grasslands Soil | DGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEVFGQAPATTAAH* |
| Ga0055490_102132311 | 3300004052 | Natural And Restored Wetlands | FEVYLDGKKVYDRKEPGAVDFLPALREIHKIRDSIKQIFADAPPAPAAH* |
| Ga0066398_100285873 | 3300004268 | Tropical Forest Soil | LDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEVFGVAVAPAAH* |
| Ga0066679_109234572 | 3300005176 | Soil | DRKEPGAVDFLPALKEIHKIRDAIKEIFAQAPPAAAKAH* |
| Ga0066678_108093332 | 3300005181 | Soil | PSDSGRFEVYLDGKKLYDRKEPGAVDFLPALREIHKIRDSIKEKFAALPPTPAPAKH* |
| Ga0066676_100558681 | 3300005186 | Soil | SDSGRFEVYLDGKKLYDRKEPGAVDFLPALKEIHKIRDAIKEIFAQAPATAGSH* |
| Ga0066676_101012385 | 3300005186 | Soil | SDSGRFEVYLDGKKLYDRKEPGAIDFLPALREIHKIRDSIKEKFAALPPTPAPAKH* |
| Ga0066388_1008606754 | 3300005332 | Tropical Forest Soil | SGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEVFGVAVAPAAH* |
| Ga0068869_1004308923 | 3300005334 | Miscanthus Rhizosphere | RFEVYLDGKKLYDRKEPGAVDFLPALKEIHKIRDAIKEVFAAAPASP* |
| Ga0070694_1011003273 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVATAPAAH* |
| Ga0070708_1000950841 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEGKVHVEIVYRVDGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFDAAPPAAAH* |
| Ga0070708_1010695462 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GKKLYDRKEPGAVDFLPALREIHKIRDAIGQIFAETPAAAASH* |
| Ga0066681_101521431 | 3300005451 | Soil | FEVYLDGKKLYDRKEPGAVDFLPALREIHKIRDSIKEKFAALPPTPAPAKH* |
| Ga0070698_1003853892 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEGKVHVEIVYRVDGKKLYDRKEPAAVDFLPALKEIHKIRDAIREVFDAAPPAAAH* |
| Ga0070697_1003261072 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEGKVHVEIVYRVDGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVF |
| Ga0066697_107902062 | 3300005540 | Soil | YVDGKKVYDRKEEGAVDFLPALREIHKIRDSIAEVFAQAPAAAAH* |
| Ga0066701_106247161 | 3300005552 | Soil | EKGRFEVYLDGKKVYDRKEPGAVDFLPALQEIHKIRDTIREMFTGEPAAAASH* |
| Ga0066698_110023441 | 3300005558 | Soil | PGAVDFLPALKEIHKIRDAIKEVFGQAPATTAAH* |
| Ga0066691_102769181 | 3300005586 | Soil | SDSGRFEVYLDGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFDAAPPAAAH* |
| Ga0066706_101104032 | 3300005598 | Soil | VYLDGKKVYDRKEPGAVDFLPALREIHKVRDTIREMFAGEPAATALH* |
| Ga0068861_1024878752 | 3300005719 | Switchgrass Rhizosphere | KLYDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAPTPAAH* |
| Ga0066903_1088310021 | 3300005764 | Tropical Forest Soil | EVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAVAPAAH* |
| Ga0066651_107408311 | 3300006031 | Soil | GAVDFLPALREIHKIRDSIKEKFAALPPTPAPAKH* |
| Ga0075419_115033351 | 3300006969 | Populus Rhizosphere | KAPGAVDFLPALKEIHKIRDAIKEIFGVATAPAAH* |
| Ga0079218_107555953 | 3300007004 | Agricultural Soil | DGKKLYDRKEPGAVDFLPALKEIHKIRDAIKDIFAAAPPAPASH* |
| Ga0079218_134968141 | 3300007004 | Agricultural Soil | PAGKGIFQVFVDGKKMYDRQEPGAVDFLPALKEIHKIRDHIKEVFAKEPAAASH* |
| Ga0066710_1023048411 | 3300009012 | Grasslands Soil | VYLDGKKVYDRKEPGAVDFLPALREIHKVRDTIREMFAGEPAATALH |
| Ga0066710_1044733272 | 3300009012 | Grasslands Soil | DGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEVFGQAPATTAAH |
| Ga0099830_102590513 | 3300009088 | Vadose Zone Soil | DGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFAAAPPVAAG* |
| Ga0114129_110634731 | 3300009147 | Populus Rhizosphere | DGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH* |
| Ga0105249_109501642 | 3300009553 | Switchgrass Rhizosphere | DGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFANAPATTGAPWIVESL* |
| Ga0105059_10039783 | 3300009795 | Groundwater Sand | YLDGKKLYDRKEPGAVDFLPALKEIHKIRETIREKFAEEPATAATH* |
| Ga0105063_10204312 | 3300009804 | Groundwater Sand | AKGVFEVFLDGKKVYDRKDPAFVDFLPALKEIHKIRETIREKFAEEPATAATH* |
| Ga0105071_10249781 | 3300009808 | Groundwater Sand | KLYDRKAPDAVDFLPALKEIHKIRDAIKEVFGQTPAPAAASH* |
| Ga0105082_11068861 | 3300009814 | Groundwater Sand | RKDPAFVDFLPALKEIHKIRETIREKFAEEPATAATH* |
| Ga0105066_10635561 | 3300009822 | Groundwater Sand | MYDRKDPAYVDFLPALKEIHKIRDAIREKFAAEPAAAATH* |
| Ga0126373_110981263 | 3300010048 | Tropical Forest Soil | EVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVATAPAAH* |
| Ga0134088_103107301 | 3300010304 | Grasslands Soil | KLYDRKAPGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH* |
| Ga0134063_100722391 | 3300010335 | Grasslands Soil | SDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH* |
| Ga0134063_101857581 | 3300010335 | Grasslands Soil | SDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGQAPATTAAH* |
| Ga0134063_102191581 | 3300010335 | Grasslands Soil | DGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFDAAPPAAAH* |
| Ga0126370_116477593 | 3300010358 | Tropical Forest Soil | YLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH* |
| Ga0126376_101002934 | 3300010359 | Tropical Forest Soil | DSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEVFGVAVAPAAH* |
| Ga0126376_101138144 | 3300010359 | Tropical Forest Soil | DSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH* |
| Ga0126376_130464281 | 3300010359 | Tropical Forest Soil | KEPGAVGFLPALKEIHKIRDAIRDVFAAAPPAAAAH* |
| Ga0126379_122373361 | 3300010366 | Tropical Forest Soil | SDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFANAPATTAAH* |
| Ga0134124_112718391 | 3300010397 | Terrestrial Soil | DGKKLYDRKEPGAVDFLPALKEIHKIRDAIKEVFAAAPASP* |
| Ga0134127_120276963 | 3300010399 | Terrestrial Soil | FEVYLDGKKLYDRKEPGAVDFLPALQEIHKIRDAIKEVFAAAPASP* |
| Ga0134123_127718331 | 3300010403 | Terrestrial Soil | KLYDRKEPGAVDFLPALKEIHKIRDAIKDVFAAAPASP* |
| Ga0137451_11558023 | 3300011438 | Soil | DRKEPGAVDFLPALKEIHKIRDAIKDVFAAAPASP* |
| Ga0137376_102455881 | 3300012208 | Vadose Zone Soil | PGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH* |
| Ga0137369_103990581 | 3300012355 | Vadose Zone Soil | EKGRFEVYVDGKKLYDRKEPGAVDSLPALREIHKIRDAIGQIFAEAPAAASH* |
| Ga0137361_105155771 | 3300012362 | Vadose Zone Soil | KLYDRKEPGAVDFLPALKEIHKIRDAIKQIFAEAPATPAAH* |
| Ga0134057_11560493 | 3300012396 | Grasslands Soil | LDGKKLYDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAPAPAAH* |
| Ga0157352_10544812 | 3300012519 | Unplanted Soil | SDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVAPAPAAH* |
| Ga0137359_112427373 | 3300012923 | Vadose Zone Soil | VYLDGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFDAAPPAAAH* |
| Ga0164301_107027611 | 3300012960 | Soil | KKLYDRKEAGAVDFLPALKEIHKIRDAIKEVFAAAPPTPAAH* |
| Ga0126369_122955771 | 3300012971 | Tropical Forest Soil | LYDRKAPGAVDFLPALKEIHKIRDAIREIFAEAPATPAAH* |
| Ga0180096_10080051 | 3300014862 | Soil | RFEVYLDGKKLYDRKEPGAVDFLPALKEIHKIRDAIKEVFAAAPPTPATH* |
| Ga0134069_13069291 | 3300017654 | Grasslands Soil | IYVDGKKVYDRKEEGAVDFLPALKEIHKIRDAIREVFDAAQPAAAH |
| Ga0134112_103961391 | 3300017656 | Grasslands Soil | KKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH |
| Ga0134112_104486741 | 3300017656 | Grasslands Soil | RKAPGAVDFLPALKEIHKIRDAIKEVFGQAPAPAAASH |
| Ga0187766_104417521 | 3300018058 | Tropical Peatland | VYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVATAPAAH |
| Ga0184627_104930761 | 3300018079 | Groundwater Sediment | KGVFEVYVDGKKVYDRKEPGAVDFLPALKEIHKIRETIREMFAEEPAVAASH |
| Ga0137417_14187365 | 3300024330 | Vadose Zone Soil | VYLDGKKLYDRKEPGAIDFLPALKEIHKIRDSIKEKFALLPPTPAPAKH |
| Ga0207685_104360932 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KKMYDRKEPGAVDFLPALREIHKIRDAVREKLGEPVPVAAAH |
| Ga0207646_110350791 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEGKVHVEIVYRVDGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFDAAPPAAAH |
| Ga0207711_109871631 | 3300025941 | Switchgrass Rhizosphere | SDSGRFEVYLDGKKLYDRKEPGAVDFLPALKEIHKIRDAIKEVFAAAPASP |
| Ga0210102_11113481 | 3300025971 | Natural And Restored Wetlands | FEVYLDGKKVYDRKEPGAVDFLPALREIHKIRDSIKQIFADAPPAPAAH |
| Ga0209438_11114551 | 3300026285 | Grasslands Soil | VYLDGKKLYDRKAPGAIDFLPALKEIHKIRDAIKEIFGVATAPAAH |
| Ga0209239_13762062 | 3300026310 | Grasslands Soil | GKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH |
| Ga0209160_12394651 | 3300026532 | Soil | EVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFAGAQPTPAAH |
| Ga0209058_10644151 | 3300026536 | Soil | LYDRKEPGAVDFLPALKEIHKIRDAIREVFDAAPPAAAH |
| Ga0209157_10701471 | 3300026537 | Soil | SGRFEVYLDGKKLYDRKEPGAVDFLPALREIHKIRDSIKEKFAALPATPAPAKH |
| Ga0209877_10175832 | 3300027032 | Groundwater Sand | KKMYDRKDPAYVDFLPALKEIHKIRDAIREKFADEPAAAATH |
| Ga0209879_10739481 | 3300027056 | Groundwater Sand | SAKGVFEVYVDGKKMYDRKDPAYVDFLPALKEIHKIRDAVREKFADEPAPAATH |
| Ga0209897_10243911 | 3300027169 | Groundwater Sand | KDPAYVDFLPALKEIHKIRDAIREKFADEPAAAATH |
| Ga0209811_101448311 | 3300027821 | Surface Soil | RKEAGAVDFLPALKEIHKIRDAIKEVFAAAPPTPAAH |
| Ga0209701_106059731 | 3300027862 | Vadose Zone Soil | DGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFAAAPPVAAG |
| Ga0209465_101254311 | 3300027874 | Tropical Forest Soil | SDSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH |
| Ga0268264_113120191 | 3300028381 | Switchgrass Rhizosphere | KKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFANAPATTGAPWIVESL |
| Ga0307305_104379663 | 3300028807 | Soil | LDGKKLYDRKEPGAVDFLPALKEIHKIRDAIRDVFAAAAPAAG |
| Ga0318571_102308411 | 3300031549 | Soil | EVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH |
| Ga0307469_112422773 | 3300031720 | Hardwood Forest Soil | EVYLDGKKLYDRKAPGAIDFLPALKEIHKIRDAIKEIFGVATAPAAH |
| Ga0307469_122031811 | 3300031720 | Hardwood Forest Soil | TGITFTPAGKGIFEVYVDGKKMYDRKEPGAVDFLPALREIHKIRDAVREKLGEPVPVAAA |
| Ga0318500_104805241 | 3300031724 | Soil | DSGRFEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH |
| Ga0318537_102229143 | 3300031763 | Soil | YLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH |
| Ga0307473_109544293 | 3300031820 | Hardwood Forest Soil | LDGKKLYDRKEPGAVDFLPALKEIHKIRDAIKEVFAAAPASP |
| Ga0307473_113636322 | 3300031820 | Hardwood Forest Soil | SDSGRFEVYLDGKKLYDRKAPGAIDFLPALKEIHKIRDAIKEIFGVAPAPAAH |
| Ga0318544_102937583 | 3300031880 | Soil | YDRKAPGAVDFLPALKEIHKIRDAIKEIFGVPVAAAH |
| Ga0318533_111782711 | 3300032059 | Soil | FEVYLDGKKLYDRKAPGAVDFLPALKEIHKIRDAIKEIFGVATAPAAH |
| Ga0310895_102430733 | 3300032122 | Soil | KAPGAIDFLPALKEIHKIRDAIKEIFGVATAPAAH |
| Ga0307471_1028837652 | 3300032180 | Hardwood Forest Soil | HVEIVYSVDGKKLYDRKEPGAVDFLPALKEIHKIRDAIREVFAAAPPAAAAH |
| Ga0307471_1043004072 | 3300032180 | Hardwood Forest Soil | KKLYDRKEPGAVDFLPALKEIHKIRDAIRQVFETPTA |
| Ga0307472_1015167952 | 3300032205 | Hardwood Forest Soil | PSDSGRFEVYLDGKKLYDRKAPGAIDFLPALKEIHKIRDAIKEIFGVAPTPAAH |
| Ga0307472_1017703993 | 3300032205 | Hardwood Forest Soil | YDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAPAPAAH |
| Ga0314802_045522_353_508 | 3300034677 | Soil | SGRFEIYLDGKKLYDRKAPGAVDFLPALKEIHKIRDSIKEIFGVAPTPAAH |
| ⦗Top⦘ |