| Basic Information | |
|---|---|
| Family ID | F099943 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ASAQLRKDQHALDAQRARIDQLINAASTSLAAHVAPPSLPS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 99.03 % |
| % of genes from short scaffolds (< 2000 bps) | 88.35 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.903 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.447 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.243 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.893 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 32.04 |
| PF00486 | Trans_reg_C | 21.36 |
| PF09678 | Caa3_CtaG | 8.74 |
| PF00578 | AhpC-TSA | 2.91 |
| PF00512 | HisKA | 1.94 |
| PF13565 | HTH_32 | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.90 % |
| Unclassified | root | N/A | 30.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101340991 | Not Available | 607 | Open in IMG/M |
| 3300005329|Ga0070683_101473352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 654 | Open in IMG/M |
| 3300005332|Ga0066388_106951746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 569 | Open in IMG/M |
| 3300005436|Ga0070713_101594981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300005436|Ga0070713_102152959 | Not Available | 540 | Open in IMG/M |
| 3300005439|Ga0070711_100282209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1314 | Open in IMG/M |
| 3300005439|Ga0070711_102065658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300005457|Ga0070662_100065197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2669 | Open in IMG/M |
| 3300005537|Ga0070730_10666509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300005549|Ga0070704_101004808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
| 3300005569|Ga0066705_10169806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1351 | Open in IMG/M |
| 3300006163|Ga0070715_10030216 | Not Available | 2188 | Open in IMG/M |
| 3300006175|Ga0070712_100796687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
| 3300006175|Ga0070712_100981715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300006354|Ga0075021_10575059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300006604|Ga0074060_11255475 | Not Available | 504 | Open in IMG/M |
| 3300006797|Ga0066659_11615435 | Not Available | 545 | Open in IMG/M |
| 3300006954|Ga0079219_11383828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300006954|Ga0079219_11838327 | Not Available | 568 | Open in IMG/M |
| 3300009036|Ga0105244_10357186 | Not Available | 673 | Open in IMG/M |
| 3300009088|Ga0099830_11366574 | Not Available | 589 | Open in IMG/M |
| 3300009520|Ga0116214_1093227 | Not Available | 1105 | Open in IMG/M |
| 3300009525|Ga0116220_10169396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 941 | Open in IMG/M |
| 3300009551|Ga0105238_10949722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300009698|Ga0116216_10280240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1017 | Open in IMG/M |
| 3300009698|Ga0116216_10616327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300010048|Ga0126373_10110979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2551 | Open in IMG/M |
| 3300010048|Ga0126373_10681150 | Not Available | 1085 | Open in IMG/M |
| 3300010048|Ga0126373_11903021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 658 | Open in IMG/M |
| 3300010049|Ga0123356_11643906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 796 | Open in IMG/M |
| 3300010371|Ga0134125_11377684 | Not Available | 769 | Open in IMG/M |
| 3300010373|Ga0134128_10903222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 978 | Open in IMG/M |
| 3300010375|Ga0105239_11454486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300010376|Ga0126381_100858576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1305 | Open in IMG/M |
| 3300010397|Ga0134124_10173899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1937 | Open in IMG/M |
| 3300010398|Ga0126383_10231137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1800 | Open in IMG/M |
| 3300012203|Ga0137399_11752671 | Not Available | 509 | Open in IMG/M |
| 3300012206|Ga0137380_10221183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1712 | Open in IMG/M |
| 3300012206|Ga0137380_10765400 | Not Available | 835 | Open in IMG/M |
| 3300012210|Ga0137378_10671927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 946 | Open in IMG/M |
| 3300012354|Ga0137366_10314561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300012357|Ga0137384_10009278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7952 | Open in IMG/M |
| 3300012363|Ga0137390_10565901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
| 3300012929|Ga0137404_11491897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300012955|Ga0164298_11563654 | Not Available | 518 | Open in IMG/M |
| 3300016371|Ga0182034_11156540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300016445|Ga0182038_10764690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 845 | Open in IMG/M |
| 3300017657|Ga0134074_1386097 | Not Available | 520 | Open in IMG/M |
| 3300017926|Ga0187807_1073132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1068 | Open in IMG/M |
| 3300017928|Ga0187806_1047707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1299 | Open in IMG/M |
| 3300017932|Ga0187814_10022471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2367 | Open in IMG/M |
| 3300017933|Ga0187801_10518440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300017943|Ga0187819_10264227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1005 | Open in IMG/M |
| 3300018037|Ga0187883_10747734 | Not Available | 511 | Open in IMG/M |
| 3300018433|Ga0066667_10092446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1987 | Open in IMG/M |
| 3300019888|Ga0193751_1236783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300020579|Ga0210407_11184503 | Not Available | 576 | Open in IMG/M |
| 3300021178|Ga0210408_10112994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2138 | Open in IMG/M |
| 3300021362|Ga0213882_10301244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300021374|Ga0213881_10083206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1375 | Open in IMG/M |
| 3300021374|Ga0213881_10261719 | Not Available | 769 | Open in IMG/M |
| 3300021420|Ga0210394_10257293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1528 | Open in IMG/M |
| 3300021559|Ga0210409_11577464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300024279|Ga0247692_1076701 | Not Available | 525 | Open in IMG/M |
| 3300024310|Ga0247681_1069828 | Not Available | 554 | Open in IMG/M |
| 3300025898|Ga0207692_10162154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1289 | Open in IMG/M |
| 3300025900|Ga0207710_10040677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2060 | Open in IMG/M |
| 3300025903|Ga0207680_10401836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300025905|Ga0207685_10022605 | Not Available | 2128 | Open in IMG/M |
| 3300025910|Ga0207684_11047305 | Not Available | 681 | Open in IMG/M |
| 3300025929|Ga0207664_10341884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1323 | Open in IMG/M |
| 3300026078|Ga0207702_11070388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 800 | Open in IMG/M |
| 3300027905|Ga0209415_11002480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300028789|Ga0302232_10335922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300028824|Ga0307310_10464585 | Not Available | 634 | Open in IMG/M |
| 3300030490|Ga0302184_10115115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1199 | Open in IMG/M |
| 3300030524|Ga0311357_10152367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2285 | Open in IMG/M |
| 3300030739|Ga0302311_10627112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300030763|Ga0265763_1014768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300031543|Ga0318516_10017480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3602 | Open in IMG/M |
| 3300031549|Ga0318571_10256978 | Not Available | 644 | Open in IMG/M |
| 3300031640|Ga0318555_10754225 | Not Available | 525 | Open in IMG/M |
| 3300031680|Ga0318574_10650367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031719|Ga0306917_10998707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300031720|Ga0307469_12201223 | Not Available | 537 | Open in IMG/M |
| 3300031792|Ga0318529_10095277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1339 | Open in IMG/M |
| 3300031797|Ga0318550_10200308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
| 3300031798|Ga0318523_10055479 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300031845|Ga0318511_10044117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1764 | Open in IMG/M |
| 3300031893|Ga0318536_10109906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1387 | Open in IMG/M |
| 3300032001|Ga0306922_10645945 | Not Available | 1118 | Open in IMG/M |
| 3300032010|Ga0318569_10581358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 522 | Open in IMG/M |
| 3300032090|Ga0318518_10270796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300032160|Ga0311301_10251428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2914 | Open in IMG/M |
| 3300032783|Ga0335079_12185185 | Not Available | 528 | Open in IMG/M |
| 3300032828|Ga0335080_11148865 | Not Available | 783 | Open in IMG/M |
| 3300032893|Ga0335069_11361682 | Not Available | 769 | Open in IMG/M |
| 3300032895|Ga0335074_11079544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300033004|Ga0335084_11182079 | Not Available | 765 | Open in IMG/M |
| 3300033134|Ga0335073_10779915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1029 | Open in IMG/M |
| 3300033158|Ga0335077_10136682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2829 | Open in IMG/M |
| 3300033289|Ga0310914_10976262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300033290|Ga0318519_10852305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 562 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.91% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 2.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1013409912 | 3300002245 | Forest Soil | ASAQLRKDQHALDAQRARIDQLINAASTSLAAHVAPPSLPS* |
| Ga0070683_1014733521 | 3300005329 | Corn Rhizosphere | PAAIDSTSAQLLRDQQAMDAQRARIDQAFTSASAALSARVAPPSLPI* |
| Ga0066388_1069517461 | 3300005332 | Tropical Forest Soil | ERTSAQLRSDQQAMDAQRARIDQLFTAASTALSAHVAPPILPG* |
| Ga0070713_1015949812 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RASGQLRRDQQALDAQRARIDRLIGTASASLAAHVPPPSLPS* |
| Ga0070713_1021529591 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTAKAPDAVAHATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0070711_1002822091 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAGKPDAVTRASGQLRRDQQALDAQRARIDRLIGAASASLAAHVPPPSLPS* |
| Ga0070711_1020656581 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GQLRRDQQALDAQRARIDRLIGTASTSLSAHVSPPSLPS* |
| Ga0070662_1000651974 | 3300005457 | Corn Rhizosphere | ATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0070730_106665092 | 3300005537 | Surface Soil | QRASAQLHHDQQALDAQRARIDQLIDAASTSLSAHVAPPSLPS* |
| Ga0070704_1010048081 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | HATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0066705_101698061 | 3300005569 | Soil | LRKDQLALDAQRARIDQLISAASTSLSAHVAPPGLPS* |
| Ga0070715_100302161 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ASARAAAAAQLRHDQLALDRERATIDKIISSADRSLSAHVAPPSLPS* |
| Ga0070712_1007966871 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVAHATAQLRKDQLALDAQRARINRLIGAASASLSAHAAPPNLPS* |
| Ga0070712_1009817152 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0075021_105750591 | 3300006354 | Watersheds | VQSASAQLRRDQQALDAERALIDRLFTSASTSLSAHVSPPSLPS* |
| Ga0074060_112554751 | 3300006604 | Soil | QLRTDQLALDAQRARVDRPISAASASLSAHVAPPNLPS* |
| Ga0066659_116154351 | 3300006797 | Soil | AIARASAQLRKDQRALDAQRARIDQVIDAASTSLSAHVAPPSLPS* |
| Ga0079219_113838281 | 3300006954 | Agricultural Soil | TLVTASKPDAVTRASGQLRRDQQALDAQRARIDRLIGTASASLAAHVPPPSLPS* |
| Ga0079219_118383271 | 3300006954 | Agricultural Soil | DQLALDAQRARINRLIGAASASLSAHVAPPNLPS* |
| Ga0105244_103571861 | 3300009036 | Miscanthus Rhizosphere | LRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0099830_113665741 | 3300009088 | Vadose Zone Soil | VAAKSLTDVQRASVQLRRDQQALDAQRALIDRLITSASMSLSAHVSPPSLPS* |
| Ga0116214_10932271 | 3300009520 | Peatlands Soil | TAKTPGAVQRASAQLRHDQQALDAERAVIDKMFTSASTSLSAHVSPPSLPS* |
| Ga0116220_101693962 | 3300009525 | Peatlands Soil | RHDQQALDAERTLIDRLITSASTSLSAHVSPPSLPS* |
| Ga0105238_109497221 | 3300009551 | Corn Rhizosphere | APDAITRATAQLRKDQLALDAQRARIDRLISAASASLSAHVAPPILPS* |
| Ga0116216_102802402 | 3300009698 | Peatlands Soil | VQSASAQLRHDQQALDAERALIDRLITSASTSLSAHVSPPSLPS* |
| Ga0116216_106163272 | 3300009698 | Peatlands Soil | AQLRHDQQALDAERALIDRLITSASTSLSAHVSPPSLPS* |
| Ga0126373_101109794 | 3300010048 | Tropical Forest Soil | ATAALRKDQQALDAQRAKIDKSISAASNALSAQVAPPNLPS* |
| Ga0126373_106811501 | 3300010048 | Tropical Forest Soil | SASGRAAAAAQLRHDQIALDRQRTTIDKIIMSADRSLSAHVAPPSLPS* |
| Ga0126373_119030212 | 3300010048 | Tropical Forest Soil | SAQLRRDEQALDAERARIDQLFTSASTALSARVPPPSLPG* |
| Ga0123356_116439062 | 3300010049 | Termite Gut | AATTPAEIASTSAQLTRDQQALDAERTRIDQLFNTASSAVSAHVAPPTLPS* |
| Ga0134125_113776841 | 3300010371 | Terrestrial Soil | TRASAQLRKDQDALDAQRARIDQSINAASTSLAAHVAPPSLPS* |
| Ga0134128_109032222 | 3300010373 | Terrestrial Soil | GQLRRDQQALDAQRARIDRLIGTASASLSAHVPPPPLPS* |
| Ga0105239_114544861 | 3300010375 | Corn Rhizosphere | AHATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0126381_1008585761 | 3300010376 | Tropical Forest Soil | TTPAEIERTSAQLRRDQQAMDAQRARINQLFIAASTALSAEVAPPSLPG* |
| Ga0134124_101738991 | 3300010397 | Terrestrial Soil | RKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR* |
| Ga0126383_102311371 | 3300010398 | Tropical Forest Soil | EIERTSAQLRRDQQAMDAERARINRLFTSASTALSANVAPPSLPG* |
| Ga0137399_117526711 | 3300012203 | Vadose Zone Soil | LVTAKAPDAVARASAQLRKDQRALDAQRARIDQRINAASTSLSAHVAPPNLPS* |
| Ga0137380_102211831 | 3300012206 | Vadose Zone Soil | DQQALDAQRTRIDRVINAASTSLSAHVSPPNLPS* |
| Ga0137380_107654002 | 3300012206 | Vadose Zone Soil | APGAITRASARLRKDQLVLDAQRARIDQLINAASTSLAAHVAPPSLPS* |
| Ga0137378_106719272 | 3300012210 | Vadose Zone Soil | AQLRKDQLALDAQRARIDQLISAASTSLPAHVAPPGLPS* |
| Ga0137366_103145612 | 3300012354 | Vadose Zone Soil | AVKRASAQLRKDQQALDAQRTRIDRVINAASTSLSAHVSPPNLPS* |
| Ga0137384_100092781 | 3300012357 | Vadose Zone Soil | ATLVTAKAPGAITRASARLRKDQLVLDAQRARIDQLINAASTSLAAHVAPPSLPS* |
| Ga0137390_105659011 | 3300012363 | Vadose Zone Soil | TAPAASQRASAQLRHDQQALDAQRARFDQLIDAASTSLSAHVAPPSLPS* |
| Ga0137404_114918971 | 3300012929 | Vadose Zone Soil | RRDQQALDAQRARIDRLIGTASTALSAHVAPPPLPS* |
| Ga0164298_115636542 | 3300012955 | Soil | QLRKDQLALDAQRARINRLIGAASASLSAHAAPPNLPS* |
| Ga0182034_111565401 | 3300016371 | Soil | PADIDAASAQLRRDQQALDAQRARINQVFTSASTALSANVAPPSLPG |
| Ga0182038_107646902 | 3300016445 | Soil | RQDQQALDAQRARVDQLINAASTSLSAHVAPPSLPS |
| Ga0134074_13860971 | 3300017657 | Grasslands Soil | HKDQLALDAQRARIDRLISAASASLSAHVAPPNLPS |
| Ga0187807_10731321 | 3300017926 | Freshwater Sediment | TIVAAKTPAEADAASAQLRRDQAALDAERGQIDKLITSASTALSAHVSPPDLPS |
| Ga0187806_10477072 | 3300017928 | Freshwater Sediment | AQLCRDQQALDVERARIDQLITSASTALTAHVSPPLLPG |
| Ga0187814_100224713 | 3300017932 | Freshwater Sediment | VQSASAQLRHDQQALDAERALIDRLITSASTSLSAHVSPPSLPS |
| Ga0187801_105184402 | 3300017933 | Freshwater Sediment | AQLRHDQRALNAERGAIDKLITSASVALSANVSAPSLPS |
| Ga0187819_102642272 | 3300017943 | Freshwater Sediment | MSAQLRRDQQALDVERARIDQLITSASTALTAHVSPPLLPG |
| Ga0187883_107477341 | 3300018037 | Peatland | TPDAIQRASAQLRHDQQALDAERAVIDKMFTSASTSLSAHVSPPSLPS |
| Ga0066667_100924463 | 3300018433 | Grasslands Soil | MAPDAITRASAQLRKDQRALDAQRSRIDQLINAASTSLAAHVAPPNLPS |
| Ga0193751_12367832 | 3300019888 | Soil | VQGASAQLGRDQQALDAQRARIDRVINSASTSVSAHVSPPSLPG |
| Ga0210407_111845032 | 3300020579 | Soil | HDQQALDAQRALIDRLITSASTSLSAHVSPPSLPS |
| Ga0210408_101129941 | 3300021178 | Soil | AITRASAQLRKDQLALDAQRARIDHVINAASTSLTAHVAPPSLPS |
| Ga0213882_103012441 | 3300021362 | Exposed Rock | ATTPAATQQASARLRHDQQALDTQRSLIDRLFSSASTSLSAHVAPPSLPS |
| Ga0213881_100832063 | 3300021374 | Exposed Rock | SSRLRHDQQALDVQRSLIDRLIDSASTSLSAHVSPPSLPS |
| Ga0213881_102617191 | 3300021374 | Exposed Rock | TPAAARRAAAQLRHDQQALDAQRARIDHLIATASTSLSARVSPPNLPS |
| Ga0210394_102572932 | 3300021420 | Soil | RASAQLRTDQHALDAQRARIDQRINAASTSLSAHVAPPSLPS |
| Ga0210409_115774642 | 3300021559 | Soil | HDQHALDAERAVIDRLITSASTSLSAHVSPPSLPS |
| Ga0247692_10767011 | 3300024279 | Soil | VAHATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR |
| Ga0247681_10698281 | 3300024310 | Soil | AQLRKDQLALDAQRARINRLIGAASASLSAHAAPPNLPR |
| Ga0207692_101621541 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AKAPDAIAHATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR |
| Ga0207710_100406771 | 3300025900 | Switchgrass Rhizosphere | KAPDAIAHATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR |
| Ga0207680_104018362 | 3300025903 | Switchgrass Rhizosphere | IAHATAQLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR |
| Ga0207685_100226053 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQLRHDQLALDRERATIDKIISSADRSLSAHVAPPSLPS |
| Ga0207684_110473051 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AQLRKDQRALDAQRARIDQRINAASTSLSAHVAPPNLPS |
| Ga0207664_103418841 | 3300025929 | Agricultural Soil | ALDAQRARIDQLINAASTSLAAHVAPPSLPSAVAD |
| Ga0207702_110703881 | 3300026078 | Corn Rhizosphere | QLRKDQLALDAQRARINRLIGAASASLSAHVAPPNLPR |
| Ga0209415_110024801 | 3300027905 | Peatlands Soil | LRHDQQALDAERALIDRLITSASTSLSAHVSPPSLPS |
| Ga0302232_103359222 | 3300028789 | Palsa | TRQLRRDQQALDAERAQIDQLINSASRSLSAHVAPPALPS |
| Ga0307310_104645852 | 3300028824 | Soil | PDAITRATAQLRKDQLALDAQRARIDRLISAASASLSAHVAPPNLPS |
| Ga0302184_101151152 | 3300030490 | Palsa | PAAIAAGTRQLRRDQQALDAERAQIDQLINSASRSLSAHVAPPALPS |
| Ga0311357_101523671 | 3300030524 | Palsa | LRRDQQALDAERAQIDQLINSASRSLSAHVAPPALPS |
| Ga0302311_106271122 | 3300030739 | Palsa | LHRDQRALDAERATIDQLINAASTSLSAHVSPPALPG |
| Ga0265763_10147681 | 3300030763 | Soil | AVQSASAQLRRDQQALDAQRALIDRLITSASTALSAHVAPPTLPS |
| Ga0318516_100174804 | 3300031543 | Soil | TPAEIDTASAQLRRDQQAMDAQRARINQAFTSASTALTAHVAPPSLPG |
| Ga0318571_102569782 | 3300031549 | Soil | TPAAVQRASAQLHHDQQALDAQRALIYQLITSASRSLSAHVPPPSLPS |
| Ga0318555_107542251 | 3300031640 | Soil | AKAPDAVNRASAQLRTDQQALDAQRARIDQLINAASTSLSAHVAPPSLPS |
| Ga0318574_106503671 | 3300031680 | Soil | ALHRDQQVLDAQRARIDGMINAASTSLSAGVSPPALPS |
| Ga0306917_109987071 | 3300031719 | Soil | TASAQLRRDQQAMDAQRARINQAFTSASTALTAHVVPPSLPG |
| Ga0307469_122012231 | 3300031720 | Hardwood Forest Soil | AQLRKDQLALDAQRARIDRLISAASASLSAHVAPPNLPS |
| Ga0318529_100952772 | 3300031792 | Soil | LRRDQQAMDAQRARINQAFTSASTALTAHVVPPSLPG |
| Ga0318550_102003082 | 3300031797 | Soil | ATRLAATTPAEIDTASAQLRRDQQAMDAQRARINQAFTSASTALTAHVVPPSLPG |
| Ga0318523_100554793 | 3300031798 | Soil | TGQLHKDQLALDAQRVRIDQVINAASTSLYAHVSPPSLPS |
| Ga0318511_100441171 | 3300031845 | Soil | ASAQLRKDQQALDAQRARIDQVFTAASTSLSAHVAPPSLPG |
| Ga0318536_101099062 | 3300031893 | Soil | PAEIDAASAQLRRDQQALDAQRARINQVFTSASTALSANVAPPSLPS |
| Ga0306922_106459451 | 3300032001 | Soil | TDQQALDAQRARIDQLINAASTSLSVHVAPPSLPS |
| Ga0318569_105813581 | 3300032010 | Soil | AQLRKDQQALDAQRARIDQVFTAASTSLSAHVAPPSLPG |
| Ga0318518_102707961 | 3300032090 | Soil | LAATTPAEIERTSAQLRRDQQAMDAERARINRLFTSASTALSANVAPPSLPS |
| Ga0311301_102514284 | 3300032160 | Peatlands Soil | SAQLRHDQQALDAERAVIDKMFTSASTSLSAHVSPPSLPS |
| Ga0335079_121851852 | 3300032783 | Soil | KAPDAVKRASAQLRKDQQALDAQRARVDQLINAASASLAAHVAPPSLPS |
| Ga0335080_111488651 | 3300032828 | Soil | ATGQLHKDQLALDAQRARIDQVINAASTSLYAHVSPPSLPS |
| Ga0335069_113616821 | 3300032893 | Soil | SDAVKHASAQLRTDQQALDAQRTRIDQLINAASTSLSAHVAPPSLPS |
| Ga0335074_110795442 | 3300032895 | Soil | ATTKAEIDAASARLRRDQQALDAERARIDKLFISASTALSAHIPPPSLPS |
| Ga0335084_111820791 | 3300033004 | Soil | AVKRASAQLRKDQQALDAQRARIDQVFDAASTSLSAHVAPPSLPS |
| Ga0335073_107799152 | 3300033134 | Soil | LRRDQRALDAERGRIDKLFTTASAALSAHVSPPSLPS |
| Ga0335077_101366821 | 3300033158 | Soil | ASAQLRRDQQALDAERAVIDRLITSASTSLSAHVSPPPLPS |
| Ga0310914_109762622 | 3300033289 | Soil | ASAQLRRDQQALDAQRARINQVFTSASTALSANVAPPSLPS |
| Ga0318519_108523052 | 3300033290 | Soil | VKGASAQLRKDQQALDAQRARIDQVFTAASTSLSAHVAPPSLPG |
| ⦗Top⦘ |