NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099933

Metagenome Family F099933

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099933
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 49 residues
Representative Sequence KIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY
Number of Associated Samples 97
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.91 %
% of genes near scaffold ends (potentially truncated) 97.09 %
% of genes from short scaffolds (< 2000 bps) 90.29 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (53.398 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.359 % of family members)
Environment Ontology (ENVO) Unclassified
(33.010 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.748 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.29%    β-sheet: 18.18%    Coil/Unstructured: 67.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF02518HATPase_c 90.29
PF00486Trans_reg_C 6.80
PF13603tRNA-synt_1_2 0.97



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A53.40 %
All OrganismsrootAll Organisms46.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002099|JGI24808J26613_1036898Not Available684Open in IMG/M
3300004114|Ga0062593_101344057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes760Open in IMG/M
3300004114|Ga0062593_102459496Not Available589Open in IMG/M
3300004157|Ga0062590_100860145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes843Open in IMG/M
3300004480|Ga0062592_102349662Not Available534Open in IMG/M
3300004778|Ga0062383_10302313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes768Open in IMG/M
3300005269|Ga0065706_1003629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium638Open in IMG/M
3300005288|Ga0065714_10241330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes794Open in IMG/M
3300005289|Ga0065704_10157781Not Available1378Open in IMG/M
3300005290|Ga0065712_10008644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2201Open in IMG/M
3300005293|Ga0065715_10982802Not Available532Open in IMG/M
3300005295|Ga0065707_10524599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes739Open in IMG/M
3300005340|Ga0070689_101032374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes732Open in IMG/M
3300005340|Ga0070689_101884594Not Available546Open in IMG/M
3300005354|Ga0070675_100841385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes839Open in IMG/M
3300005355|Ga0070671_102054771Not Available509Open in IMG/M
3300005365|Ga0070688_100352701Not Available1077Open in IMG/M
3300005518|Ga0070699_100981409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium774Open in IMG/M
3300005539|Ga0068853_100333152Not Available1409Open in IMG/M
3300005543|Ga0070672_101398438Not Available626Open in IMG/M
3300005564|Ga0070664_101295656Not Available688Open in IMG/M
3300005617|Ga0068859_100020034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea6717Open in IMG/M
3300005617|Ga0068859_100107278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2853Open in IMG/M
3300005833|Ga0074472_11367103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes753Open in IMG/M
3300005842|Ga0068858_100049735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea3881Open in IMG/M
3300005943|Ga0073926_10066687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes710Open in IMG/M
3300006031|Ga0066651_10016960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3071Open in IMG/M
3300006163|Ga0070715_10143927Not Available1161Open in IMG/M
3300006845|Ga0075421_101335915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes792Open in IMG/M
3300006853|Ga0075420_100669565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes895Open in IMG/M
3300006876|Ga0079217_10979248Not Available615Open in IMG/M
3300006918|Ga0079216_10165886Not Available1170Open in IMG/M
3300006969|Ga0075419_11269558Not Available546Open in IMG/M
3300009094|Ga0111539_10925198Not Available1014Open in IMG/M
3300009094|Ga0111539_10926122Not Available1013Open in IMG/M
3300009553|Ga0105249_10513694Not Available1245Open in IMG/M
3300009553|Ga0105249_10601638Not Available1154Open in IMG/M
3300009610|Ga0105340_1402401Not Available610Open in IMG/M
3300009789|Ga0126307_10494057Not Available987Open in IMG/M
3300010037|Ga0126304_10067688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2203Open in IMG/M
3300010166|Ga0126306_11375506Not Available583Open in IMG/M
3300010399|Ga0134127_13476108Not Available516Open in IMG/M
3300010403|Ga0134123_13045212Not Available537Open in IMG/M
3300011119|Ga0105246_10181365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1621Open in IMG/M
3300011398|Ga0137348_1072882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes592Open in IMG/M
3300011442|Ga0137437_1158786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes783Open in IMG/M
3300012043|Ga0136631_10347477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes596Open in IMG/M
3300012882|Ga0157304_1026252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes775Open in IMG/M
3300012885|Ga0157287_1030434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes762Open in IMG/M
3300012885|Ga0157287_1097064Not Available541Open in IMG/M
3300012893|Ga0157284_10061732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes886Open in IMG/M
3300012900|Ga0157292_10217208Not Available648Open in IMG/M
3300012902|Ga0157291_10075049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes863Open in IMG/M
3300012903|Ga0157289_10055307Not Available1019Open in IMG/M
3300012904|Ga0157282_10198334Not Available647Open in IMG/M
3300012906|Ga0157295_10344113Not Available537Open in IMG/M
3300012907|Ga0157283_10055163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes926Open in IMG/M
3300012911|Ga0157301_10418766Not Available523Open in IMG/M
3300012912|Ga0157306_10307495Not Available584Open in IMG/M
3300012913|Ga0157298_10059332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes912Open in IMG/M
3300012984|Ga0164309_11593526Not Available559Open in IMG/M
3300013297|Ga0157378_13023210Not Available522Open in IMG/M
3300013308|Ga0157375_12258150Not Available648Open in IMG/M
3300014325|Ga0163163_12403941Not Available585Open in IMG/M
3300014326|Ga0157380_11969920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes646Open in IMG/M
3300014969|Ga0157376_12270051Not Available582Open in IMG/M
3300015200|Ga0173480_10340880All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes851Open in IMG/M
3300017792|Ga0163161_11350807Not Available621Open in IMG/M
3300018067|Ga0184611_1022723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1947Open in IMG/M
3300018079|Ga0184627_10433957Not Available683Open in IMG/M
3300018469|Ga0190270_12156320Not Available617Open in IMG/M
3300019356|Ga0173481_10618617Not Available572Open in IMG/M
3300019361|Ga0173482_10324154Not Available687Open in IMG/M
3300019362|Ga0173479_10200211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes842Open in IMG/M
3300019871|Ga0193702_1007178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1483Open in IMG/M
3300020009|Ga0193740_1061249Not Available575Open in IMG/M
3300020020|Ga0193738_1000045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes82516Open in IMG/M
3300022886|Ga0247746_1005524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2453Open in IMG/M
3300022906|Ga0247766_1007606Not Available2336Open in IMG/M
3300022908|Ga0247779_1186919Not Available544Open in IMG/M
3300023064|Ga0247801_1005573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1466Open in IMG/M
3300023069|Ga0247751_1071841Not Available600Open in IMG/M
3300023071|Ga0247752_1076933Not Available552Open in IMG/M
3300023270|Ga0247784_1110045Not Available706Open in IMG/M
3300024055|Ga0247794_10093045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes887Open in IMG/M
3300025930|Ga0207701_10756367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes821Open in IMG/M
3300025931|Ga0207644_11117649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes662Open in IMG/M
3300025940|Ga0207691_10658925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes884Open in IMG/M
3300025942|Ga0207689_10981625Not Available713Open in IMG/M
3300025945|Ga0207679_11098725All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes730Open in IMG/M
3300025961|Ga0207712_11455924Not Available613Open in IMG/M
3300026116|Ga0207674_10986703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes811Open in IMG/M
3300026306|Ga0209468_1083234Not Available1064Open in IMG/M
3300027395|Ga0209996_1019682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes943Open in IMG/M
3300027843|Ga0209798_10014814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4229Open in IMG/M
3300027886|Ga0209486_10084328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1658Open in IMG/M
3300028380|Ga0268265_11433870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes693Open in IMG/M
3300031538|Ga0310888_10130875Not Available1316Open in IMG/M
3300031858|Ga0310892_10569844Not Available763Open in IMG/M
3300031908|Ga0310900_11545740Not Available560Open in IMG/M
3300031944|Ga0310884_10301742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes893Open in IMG/M
3300032013|Ga0310906_11103979Not Available574Open in IMG/M
3300032275|Ga0315270_10175531Not Available1303Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.91%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.91%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.97%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.97%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005269Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk SoilEnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023270Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027395Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24808J26613_103689823300002099SoilKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY*
Ga0062593_10134405713300004114SoilKGQKMQEVDFKMKNDSCNHFFFLLNEIRMSTKMSGEAIDFLNALEQGMPTYY*
Ga0062593_10245949613300004114SoilKMFFYNKGQKIQEVDFKMKNDSCNHFFFLLNKNRMSTKMSGEAIDFLNALEQGMPTYY*
Ga0062590_10086014523300004157SoilNGQEIQEVDFKMKNDSCNHFVFRLNGNLVSTKMNSEAVDFLDALEKGMPVYY*
Ga0062592_10234966223300004480SoilKGEKMQEVDFKMKDRACNHFYFLIDGKPMSTKMSDEAIDFLDALEKGMPYY*
Ga0062383_1030231323300004778Wetland SedimentGERMQEVDFKMKNDSCNHFAFLLNGKLFSTKMSDEAVDFLDALEKGLPTYY*
Ga0065706_100362923300005269Switchgrass RhizosphereMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY*
Ga0065714_1024133023300005288Miscanthus RhizosphereCFFNGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0065704_1015778123300005289Switchgrass RhizosphereKMKNDSCNHFAFLLNGKLMSTKMNNEAIDFLNALEQGMPTYY*
Ga0065712_1000864433300005290Miscanthus RhizosphereDFKMKNDSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPTYY*
Ga0065715_1098280223300005293Miscanthus RhizosphereGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0065707_1052459923300005295Switchgrass RhizosphereNDSCNHFAFLLDGKLMSTKMNSEAVDFLDALEKGMPVYY*
Ga0070689_10103237413300005340Switchgrass RhizosphereKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0070689_10188459423300005340Switchgrass RhizosphereKETKPFDCGYDGKMFFFKKGNKIQEVDFKTTNDSCNHFAFRLNDKLIRTRVSNEAVDFLNALEQGLPTYY*
Ga0070675_10084138523300005354Miscanthus RhizosphereGYDGKMFFYHNGQEIQEVDFKMKNDSCNHFAFLLSGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0070671_10205477113300005355Switchgrass RhizosphereKGEKIQEVDFKMKDDSCNHFAFLLNGKMMSTKMNSEAVDFLDALEKGLPTYY*
Ga0070688_10035270113300005365Switchgrass RhizosphereIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0070699_10098140913300005518Corn, Switchgrass And Miscanthus RhizosphereFFYKKGNKIQEVDFKMKNDSCNHFAFMLNGKLMSTRMRDEAVDFLDALERGMPYY*
Ga0068853_10033315213300005539Corn RhizosphereGQEIQEVDFKMKNDSCNHFAFLLSGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0070672_10139843813300005543Miscanthus RhizosphereDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY*
Ga0070664_10129565623300005564Corn RhizosphereSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0068859_10002003463300005617Switchgrass RhizosphereFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0068859_10010727813300005617Switchgrass RhizosphereKPFDCGYDGKMFFFKKGNKIQEVDFKTTNDSCNHFAFKLNDKLIRTRVSNEAVDFLNALEQGLPTYY*
Ga0074472_1136710313300005833Sediment (Intertidal)DGKMFFYKEGQQIQEVDFKMNNEACNHFAFLLDGKLMSTKMKNEGVDFLNALEQGLPFY*
Ga0068858_10004973543300005842Switchgrass RhizosphereQKIQEVDFKMKNDSCNHFAFLINGNLMSTKMSGEAIDFLNALEEGMPAYY*
Ga0073926_1006668723300005943SandLQIQELDFKMKDETCNHFAFLLNGKLMCTKMKNEGVDFLNALEQGLPFY*
Ga0066651_1001696043300006031SoilGYDGKMFFYAKGQKIQEVDFKMKNDSCNHFSFLLNGKMISTKMNNEAVDFLDALEKGLPTYY*
Ga0070715_1014392723300006163Corn, Switchgrass And Miscanthus RhizosphereMKNDSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPVYY*
Ga0075421_10133591513300006845Populus RhizosphereGKMFFYIKGQKIQEVDFKMKNDSCNHFAFSLNGNLMSTKMSGEAIDFLNALEQGMPIYY*
Ga0075420_10066956513300006853Populus RhizosphereQEVDFKMKNDSCNHFAFLLNGKLMSTKMSGEAVDFFDALEKGLPTYY*
Ga0079217_1097924823300006876Agricultural SoilYEKDSIIQEVDFQMKNEQCRHFVFLLDGKLMSTRMNQEATDFLDALQRGLPTYY*
Ga0079216_1016588613300006918Agricultural SoilGNDSCSHFVFLLDGKLHSTKMNNEASDFLESLEKGRTVY*
Ga0075419_1126955813300006969Populus RhizosphereMKNDSCNHFVFRLNGNLVRTKMNSEAVDLLDALEKGMPYY*
Ga0111539_1092519823300009094Populus RhizosphereCGYDGKMFFYNKGQKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAVDFLNALEQGMPIYY*
Ga0111539_1092612213300009094Populus RhizosphereNDSCNHFAFLLNGNLISTKMSGEAIDFLNALEQGLPIYY*
Ga0105249_1051369413300009553Switchgrass RhizosphereKNDSCSHFAFMLNGKLMSTRMRNEAADFFDALERNMPFY*
Ga0105249_1060163813300009553Switchgrass RhizosphereKGQKIQEVDFKMKDDSCNHFAFELNGKLMKTKMNSEAVDFLDALEKGMPYY*
Ga0105340_140240123300009610SoilFYNKGQKIQEVDFKMKNDSCNHFFFLLNETRMSTKMSGEAIDFLNALEQGMPIYY*
Ga0126307_1049405723300009789Serpentine SoilNHFAFLLNGKLLNTKMSGEAIDFLNALEQGMPTYY*
Ga0126304_1006768813300010037Serpentine SoilTRGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMSGEAIDFLNALEQGMPIYY*
Ga0126306_1137550613300010166Serpentine SoilKNDSCNHFAFLLNGKLTSTKMSGEAIDFLNALEQGMPAYY*
Ga0134127_1347610823300010399Terrestrial SoilCNHFAFLLNGKLMSTKMSGEAVDFLDALEKGLPTYY*
Ga0134123_1304521213300010403Terrestrial SoilNDSCNHFTFLLKDKRIATKMSGEAVDFLDALEKGLPTYY*
Ga0105246_1018136513300011119Miscanthus RhizosphereHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0137348_107288213300011398SoilKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAVDFLNALEQGMPIYY*
Ga0137437_115878623300011442SoilQKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAIDFLNALEQGMPTYY*
Ga0136631_1034747733300012043Polar Desert SandLMMKDKTCRHFSFMLNNKLMSTKMNNEAVDFFPGLEEGRNWY*
Ga0157304_102625213300012882SoilNKGQKIQEVDFKMKNDSCNHFAFLLDGKLMSTKMNSEAVDFLDALEKGMPVYY*
Ga0157287_103043413300012885SoilNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY*
Ga0157287_109706423300012885SoilYTKGQKMQEVDFKMKNDSCNHFAFLLNGNLISTKMSGEAIDFLNALEQGMPIYY*
Ga0157284_1006173213300012893SoilCGYDGKMFFYHNGQEIQEVDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY*
Ga0157292_1021720823300012900SoilFYYKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY*
Ga0157291_1007504913300012902SoilYDGKMFFYAKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY*
Ga0157289_1005530713300012903SoilDFKMKNDSCNHFFFLLNENRMSTKMSGEAIDFLNALEQGMPTYY*
Ga0157282_1019833413300012904SoilKMQEVDFKMKNDSCNHFFFLLNEIRMSTKMSGEAIDFLNALEQGMPIYY*
Ga0157295_1034411323300012906SoilKMKNDSCNHFAFLLNGKLLSTKMNNEAVDFLDALEKGLPTYY*
Ga0157283_1005516323300012907SoilFKMKDDSCNHFAFLLNGKLMSTEMNNEAVDFLDALEKGLPTYY*
Ga0157301_1041876623300012911SoilMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPVYY*
Ga0157306_1030749513300012912SoilGQQMQEVDFKMKNDSCNHFAFLLNGKLMSTKMSGVAIDFLNALEQGMPTYY*
Ga0157298_1005933223300012913SoilNHFVFRLNGKLVRTKMNSEAVDFLDALEKGMPYY*
Ga0164309_1159352623300012984SoilDGKMFFYHKGEKIQEVDFKMKDDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY
Ga0157378_1302321023300013297Miscanthus RhizosphereHFAFLVNGNLVSTKMSGEAIDFLNALEQGMPVYY*
Ga0157375_1225815013300013308Miscanthus RhizosphereQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0163163_1240394113300014325Switchgrass RhizosphereEVDFKMKNDSCNHFAFLLNGKLLSTKMNNEAVDFLDALEKGLPTYY*
Ga0157380_1196992023300014326Switchgrass RhizosphereMFFYDKGQKMQEVDFKMKNDSCNHFAFLLNGKLISTKMSGEAIDFLNALEQGMPIYY*
Ga0157376_1227005123300014969Miscanthus RhizosphereCGDDGKMFFYHKGQKMQEVDFKMKDNSCNHFAFLVNEKLVTLKMSEEAIDFLDALEKGMPYY*
Ga0173480_1034088023300015200SoilYDGKMFFYHNGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY*
Ga0163161_1135080713300017792Switchgrass RhizosphereDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY
Ga0184611_102272333300018067Groundwater SedimentDGKMFFYHNGQEIQEVDFKMKNDSCNHFVFRLNGNLVSTKMNSEAVDFLDALEKGMPYY
Ga0184627_1043395723300018079Groundwater SedimentKDDSCRHFSFLLNGKLTSTKMNNEAVDFLDALEKGMPYYW
Ga0190270_1215632013300018469SoilDFKMKIDSCRHFSFLLNGQLMSTKLNNEAADFLDALEKGLPVYW
Ga0173481_1061861713300019356SoilEIQEVDFKMKNDSCNHFVFKLNGNLVSTKMNNEAVDFLDALEKGLPTYY
Ga0173482_1032415423300019361SoilKNDSCNHFVFRLNGNLVSTKMNSEAIDFLDALEKGMPYY
Ga0173479_1020021123300019362SoilFKMKNDSCNHFAFLLNGTLTSTKMSGEAIDFLNALEQGMPAYY
Ga0193702_100717833300019871SoilYHNGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY
Ga0193740_106124923300020009SoilFFYNKGQKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAKDFLNALEQGMPIYY
Ga0193738_1000045573300020020SoilDDSCNHFSFLLNGKIMSTKINSEAVDFLDALEKGMPYYY
Ga0247746_100552443300022886SoilKIQEVDFKMKNDSCNHFAFLLDGKLMSTKMNSEAVDFLDALEKGMPVYY
Ga0247766_100760643300022906Plant LitterQEVDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY
Ga0247779_118691913300022908Plant LitterKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY
Ga0247801_100557313300023064SoilKMKNDSCNHFVFRLNGNLVSTKMNSEAVDFLDALEKGMPYY
Ga0247751_107184113300023069SoilNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY
Ga0247752_107693323300023071SoilNHFFFLLNENKVSTKMSGEAIDFLNALEQGMPTYY
Ga0247784_111004513300023270Plant LitterEQGNCGNDGKMFFYYKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY
Ga0247794_1009304513300024055SoilSQKIQEVDFKMKNDSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPTYY
Ga0207701_1075636723300025930Corn, Switchgrass And Miscanthus RhizosphereIQEVDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY
Ga0207644_1111764923300025931Switchgrass RhizosphereSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPTYY
Ga0207691_1065892523300025940Miscanthus RhizosphereFFYHKGEKIQEVDFKMKDDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY
Ga0207689_1098162513300025942Miscanthus RhizosphereSKETKPFDCGYDGKMFFFKKGNKIQEVDFKTTNDSCNHFAFRLNDKLIRTRVSNEAVDFLNALEQGLPTYY
Ga0207679_1109872513300025945Corn RhizosphereSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY
Ga0207712_1145592423300025961Switchgrass RhizosphereGQKIQEVDFKMKDDSCNHFAFELNGKLMKTKMNSEAVDFLDALEKGMPYY
Ga0207674_1098670313300026116Corn RhizosphereDGKMFFYTKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGMPTYY
Ga0209468_108323413300026306SoilKIQEVDFKMKNDSCNHFSFLLNGKMISTKMNNEAVDFLDALEKGLPTYY
Ga0209996_101968223300027395Arabidopsis Thaliana RhizosphereQKIQEVDFKMKNDSCNHFFFLLNKNRMSTKMSGEAIDFLNALEQGMPTYY
Ga0209798_1001481413300027843Wetland SedimentSDDACNHFAFMLNGKLINTTMKNEAVDFFDALGKGLPFY
Ga0209486_1008432813300027886Agricultural SoilKGQKIQEVDFKMKDDSCNHFAFELSGKLVRTKMNSEAVDFLDALEKGMPYY
Ga0268265_1143387023300028380Switchgrass RhizosphereQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAIDFLNALEQGMPVYY
Ga0310888_1013087513300031538SoilNHFAFLLNGNLMSTKMSGEAIDFLNALEQGMPIYY
Ga0310892_1056984413300031858SoilMFFYAKGQKLQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGMPTYY
Ga0310900_1154574023300031908SoilGKMFFYNKGQKIQEVDFKMKNDSCNHFALLVNGKLTGTKMSNEAIDFLNALEQGMPTYY
Ga0310884_1030174213300031944SoilKGQKIQEVDFKLKDDSCNHFAFFLNEKLVSTKMNSEAVDFLDALEKGLPTYY
Ga0310906_1110397913300032013SoilRCGYDGKMFFYHNGQEIQEVDFKMKNDSCNHFVFRLNGNLVSTKMNSEAIDFLDALEKGMPYY
Ga0315270_1017553113300032275SedimentQKFQEVDFKMKNDSCNHFAFLLNGKLTSTKMSNEAIDFLNALDQGLPIYY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.