| Basic Information | |
|---|---|
| Family ID | F099933 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 49 residues |
| Representative Sequence | KIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.91 % |
| % of genes near scaffold ends (potentially truncated) | 97.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.398 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.359 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.010 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 18.18% Coil/Unstructured: 67.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 90.29 |
| PF00486 | Trans_reg_C | 6.80 |
| PF13603 | tRNA-synt_1_2 | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.40 % |
| All Organisms | root | All Organisms | 46.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002099|JGI24808J26613_1036898 | Not Available | 684 | Open in IMG/M |
| 3300004114|Ga0062593_101344057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 760 | Open in IMG/M |
| 3300004114|Ga0062593_102459496 | Not Available | 589 | Open in IMG/M |
| 3300004157|Ga0062590_100860145 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 843 | Open in IMG/M |
| 3300004480|Ga0062592_102349662 | Not Available | 534 | Open in IMG/M |
| 3300004778|Ga0062383_10302313 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 768 | Open in IMG/M |
| 3300005269|Ga0065706_1003629 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 638 | Open in IMG/M |
| 3300005288|Ga0065714_10241330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 794 | Open in IMG/M |
| 3300005289|Ga0065704_10157781 | Not Available | 1378 | Open in IMG/M |
| 3300005290|Ga0065712_10008644 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2201 | Open in IMG/M |
| 3300005293|Ga0065715_10982802 | Not Available | 532 | Open in IMG/M |
| 3300005295|Ga0065707_10524599 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 739 | Open in IMG/M |
| 3300005340|Ga0070689_101032374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 732 | Open in IMG/M |
| 3300005340|Ga0070689_101884594 | Not Available | 546 | Open in IMG/M |
| 3300005354|Ga0070675_100841385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 839 | Open in IMG/M |
| 3300005355|Ga0070671_102054771 | Not Available | 509 | Open in IMG/M |
| 3300005365|Ga0070688_100352701 | Not Available | 1077 | Open in IMG/M |
| 3300005518|Ga0070699_100981409 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 774 | Open in IMG/M |
| 3300005539|Ga0068853_100333152 | Not Available | 1409 | Open in IMG/M |
| 3300005543|Ga0070672_101398438 | Not Available | 626 | Open in IMG/M |
| 3300005564|Ga0070664_101295656 | Not Available | 688 | Open in IMG/M |
| 3300005617|Ga0068859_100020034 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 6717 | Open in IMG/M |
| 3300005617|Ga0068859_100107278 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2853 | Open in IMG/M |
| 3300005833|Ga0074472_11367103 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 753 | Open in IMG/M |
| 3300005842|Ga0068858_100049735 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 3881 | Open in IMG/M |
| 3300005943|Ga0073926_10066687 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 710 | Open in IMG/M |
| 3300006031|Ga0066651_10016960 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3071 | Open in IMG/M |
| 3300006163|Ga0070715_10143927 | Not Available | 1161 | Open in IMG/M |
| 3300006845|Ga0075421_101335915 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 792 | Open in IMG/M |
| 3300006853|Ga0075420_100669565 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 895 | Open in IMG/M |
| 3300006876|Ga0079217_10979248 | Not Available | 615 | Open in IMG/M |
| 3300006918|Ga0079216_10165886 | Not Available | 1170 | Open in IMG/M |
| 3300006969|Ga0075419_11269558 | Not Available | 546 | Open in IMG/M |
| 3300009094|Ga0111539_10925198 | Not Available | 1014 | Open in IMG/M |
| 3300009094|Ga0111539_10926122 | Not Available | 1013 | Open in IMG/M |
| 3300009553|Ga0105249_10513694 | Not Available | 1245 | Open in IMG/M |
| 3300009553|Ga0105249_10601638 | Not Available | 1154 | Open in IMG/M |
| 3300009610|Ga0105340_1402401 | Not Available | 610 | Open in IMG/M |
| 3300009789|Ga0126307_10494057 | Not Available | 987 | Open in IMG/M |
| 3300010037|Ga0126304_10067688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2203 | Open in IMG/M |
| 3300010166|Ga0126306_11375506 | Not Available | 583 | Open in IMG/M |
| 3300010399|Ga0134127_13476108 | Not Available | 516 | Open in IMG/M |
| 3300010403|Ga0134123_13045212 | Not Available | 537 | Open in IMG/M |
| 3300011119|Ga0105246_10181365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1621 | Open in IMG/M |
| 3300011398|Ga0137348_1072882 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 592 | Open in IMG/M |
| 3300011442|Ga0137437_1158786 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 783 | Open in IMG/M |
| 3300012043|Ga0136631_10347477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 596 | Open in IMG/M |
| 3300012882|Ga0157304_1026252 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 775 | Open in IMG/M |
| 3300012885|Ga0157287_1030434 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 762 | Open in IMG/M |
| 3300012885|Ga0157287_1097064 | Not Available | 541 | Open in IMG/M |
| 3300012893|Ga0157284_10061732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 886 | Open in IMG/M |
| 3300012900|Ga0157292_10217208 | Not Available | 648 | Open in IMG/M |
| 3300012902|Ga0157291_10075049 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 863 | Open in IMG/M |
| 3300012903|Ga0157289_10055307 | Not Available | 1019 | Open in IMG/M |
| 3300012904|Ga0157282_10198334 | Not Available | 647 | Open in IMG/M |
| 3300012906|Ga0157295_10344113 | Not Available | 537 | Open in IMG/M |
| 3300012907|Ga0157283_10055163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 926 | Open in IMG/M |
| 3300012911|Ga0157301_10418766 | Not Available | 523 | Open in IMG/M |
| 3300012912|Ga0157306_10307495 | Not Available | 584 | Open in IMG/M |
| 3300012913|Ga0157298_10059332 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 912 | Open in IMG/M |
| 3300012984|Ga0164309_11593526 | Not Available | 559 | Open in IMG/M |
| 3300013297|Ga0157378_13023210 | Not Available | 522 | Open in IMG/M |
| 3300013308|Ga0157375_12258150 | Not Available | 648 | Open in IMG/M |
| 3300014325|Ga0163163_12403941 | Not Available | 585 | Open in IMG/M |
| 3300014326|Ga0157380_11969920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 646 | Open in IMG/M |
| 3300014969|Ga0157376_12270051 | Not Available | 582 | Open in IMG/M |
| 3300015200|Ga0173480_10340880 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 851 | Open in IMG/M |
| 3300017792|Ga0163161_11350807 | Not Available | 621 | Open in IMG/M |
| 3300018067|Ga0184611_1022723 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1947 | Open in IMG/M |
| 3300018079|Ga0184627_10433957 | Not Available | 683 | Open in IMG/M |
| 3300018469|Ga0190270_12156320 | Not Available | 617 | Open in IMG/M |
| 3300019356|Ga0173481_10618617 | Not Available | 572 | Open in IMG/M |
| 3300019361|Ga0173482_10324154 | Not Available | 687 | Open in IMG/M |
| 3300019362|Ga0173479_10200211 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 842 | Open in IMG/M |
| 3300019871|Ga0193702_1007178 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1483 | Open in IMG/M |
| 3300020009|Ga0193740_1061249 | Not Available | 575 | Open in IMG/M |
| 3300020020|Ga0193738_1000045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 82516 | Open in IMG/M |
| 3300022886|Ga0247746_1005524 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2453 | Open in IMG/M |
| 3300022906|Ga0247766_1007606 | Not Available | 2336 | Open in IMG/M |
| 3300022908|Ga0247779_1186919 | Not Available | 544 | Open in IMG/M |
| 3300023064|Ga0247801_1005573 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1466 | Open in IMG/M |
| 3300023069|Ga0247751_1071841 | Not Available | 600 | Open in IMG/M |
| 3300023071|Ga0247752_1076933 | Not Available | 552 | Open in IMG/M |
| 3300023270|Ga0247784_1110045 | Not Available | 706 | Open in IMG/M |
| 3300024055|Ga0247794_10093045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 887 | Open in IMG/M |
| 3300025930|Ga0207701_10756367 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 821 | Open in IMG/M |
| 3300025931|Ga0207644_11117649 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 662 | Open in IMG/M |
| 3300025940|Ga0207691_10658925 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 884 | Open in IMG/M |
| 3300025942|Ga0207689_10981625 | Not Available | 713 | Open in IMG/M |
| 3300025945|Ga0207679_11098725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 730 | Open in IMG/M |
| 3300025961|Ga0207712_11455924 | Not Available | 613 | Open in IMG/M |
| 3300026116|Ga0207674_10986703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 811 | Open in IMG/M |
| 3300026306|Ga0209468_1083234 | Not Available | 1064 | Open in IMG/M |
| 3300027395|Ga0209996_1019682 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 943 | Open in IMG/M |
| 3300027843|Ga0209798_10014814 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4229 | Open in IMG/M |
| 3300027886|Ga0209486_10084328 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1658 | Open in IMG/M |
| 3300028380|Ga0268265_11433870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 693 | Open in IMG/M |
| 3300031538|Ga0310888_10130875 | Not Available | 1316 | Open in IMG/M |
| 3300031858|Ga0310892_10569844 | Not Available | 763 | Open in IMG/M |
| 3300031908|Ga0310900_11545740 | Not Available | 560 | Open in IMG/M |
| 3300031944|Ga0310884_10301742 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 893 | Open in IMG/M |
| 3300032013|Ga0310906_11103979 | Not Available | 574 | Open in IMG/M |
| 3300032275|Ga0315270_10175531 | Not Available | 1303 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005269 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk Soil | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022906 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6 | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24808J26613_10368982 | 3300002099 | Soil | KIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY* |
| Ga0062593_1013440571 | 3300004114 | Soil | KGQKMQEVDFKMKNDSCNHFFFLLNEIRMSTKMSGEAIDFLNALEQGMPTYY* |
| Ga0062593_1024594961 | 3300004114 | Soil | KMFFYNKGQKIQEVDFKMKNDSCNHFFFLLNKNRMSTKMSGEAIDFLNALEQGMPTYY* |
| Ga0062590_1008601452 | 3300004157 | Soil | NGQEIQEVDFKMKNDSCNHFVFRLNGNLVSTKMNSEAVDFLDALEKGMPVYY* |
| Ga0062592_1023496622 | 3300004480 | Soil | KGEKMQEVDFKMKDRACNHFYFLIDGKPMSTKMSDEAIDFLDALEKGMPYY* |
| Ga0062383_103023132 | 3300004778 | Wetland Sediment | GERMQEVDFKMKNDSCNHFAFLLNGKLFSTKMSDEAVDFLDALEKGLPTYY* |
| Ga0065706_10036292 | 3300005269 | Switchgrass Rhizosphere | MKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY* |
| Ga0065714_102413302 | 3300005288 | Miscanthus Rhizosphere | CFFNGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0065704_101577812 | 3300005289 | Switchgrass Rhizosphere | KMKNDSCNHFAFLLNGKLMSTKMNNEAIDFLNALEQGMPTYY* |
| Ga0065712_100086443 | 3300005290 | Miscanthus Rhizosphere | DFKMKNDSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPTYY* |
| Ga0065715_109828022 | 3300005293 | Miscanthus Rhizosphere | GQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0065707_105245992 | 3300005295 | Switchgrass Rhizosphere | NDSCNHFAFLLDGKLMSTKMNSEAVDFLDALEKGMPVYY* |
| Ga0070689_1010323741 | 3300005340 | Switchgrass Rhizosphere | KMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0070689_1018845942 | 3300005340 | Switchgrass Rhizosphere | KETKPFDCGYDGKMFFFKKGNKIQEVDFKTTNDSCNHFAFRLNDKLIRTRVSNEAVDFLNALEQGLPTYY* |
| Ga0070675_1008413852 | 3300005354 | Miscanthus Rhizosphere | GYDGKMFFYHNGQEIQEVDFKMKNDSCNHFAFLLSGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0070671_1020547711 | 3300005355 | Switchgrass Rhizosphere | KGEKIQEVDFKMKDDSCNHFAFLLNGKMMSTKMNSEAVDFLDALEKGLPTYY* |
| Ga0070688_1003527011 | 3300005365 | Switchgrass Rhizosphere | IQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0070699_1009814091 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FFYKKGNKIQEVDFKMKNDSCNHFAFMLNGKLMSTRMRDEAVDFLDALERGMPYY* |
| Ga0068853_1003331521 | 3300005539 | Corn Rhizosphere | GQEIQEVDFKMKNDSCNHFAFLLSGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0070672_1013984381 | 3300005543 | Miscanthus Rhizosphere | DFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY* |
| Ga0070664_1012956562 | 3300005564 | Corn Rhizosphere | SCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0068859_1000200346 | 3300005617 | Switchgrass Rhizosphere | FKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0068859_1001072781 | 3300005617 | Switchgrass Rhizosphere | KPFDCGYDGKMFFFKKGNKIQEVDFKTTNDSCNHFAFKLNDKLIRTRVSNEAVDFLNALEQGLPTYY* |
| Ga0074472_113671031 | 3300005833 | Sediment (Intertidal) | DGKMFFYKEGQQIQEVDFKMNNEACNHFAFLLDGKLMSTKMKNEGVDFLNALEQGLPFY* |
| Ga0068858_1000497354 | 3300005842 | Switchgrass Rhizosphere | QKIQEVDFKMKNDSCNHFAFLINGNLMSTKMSGEAIDFLNALEEGMPAYY* |
| Ga0073926_100666872 | 3300005943 | Sand | LQIQELDFKMKDETCNHFAFLLNGKLMCTKMKNEGVDFLNALEQGLPFY* |
| Ga0066651_100169604 | 3300006031 | Soil | GYDGKMFFYAKGQKIQEVDFKMKNDSCNHFSFLLNGKMISTKMNNEAVDFLDALEKGLPTYY* |
| Ga0070715_101439272 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNDSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPVYY* |
| Ga0075421_1013359151 | 3300006845 | Populus Rhizosphere | GKMFFYIKGQKIQEVDFKMKNDSCNHFAFSLNGNLMSTKMSGEAIDFLNALEQGMPIYY* |
| Ga0075420_1006695651 | 3300006853 | Populus Rhizosphere | QEVDFKMKNDSCNHFAFLLNGKLMSTKMSGEAVDFFDALEKGLPTYY* |
| Ga0079217_109792482 | 3300006876 | Agricultural Soil | YEKDSIIQEVDFQMKNEQCRHFVFLLDGKLMSTRMNQEATDFLDALQRGLPTYY* |
| Ga0079216_101658861 | 3300006918 | Agricultural Soil | GNDSCSHFVFLLDGKLHSTKMNNEASDFLESLEKGRTVY* |
| Ga0075419_112695581 | 3300006969 | Populus Rhizosphere | MKNDSCNHFVFRLNGNLVRTKMNSEAVDLLDALEKGMPYY* |
| Ga0111539_109251982 | 3300009094 | Populus Rhizosphere | CGYDGKMFFYNKGQKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAVDFLNALEQGMPIYY* |
| Ga0111539_109261221 | 3300009094 | Populus Rhizosphere | NDSCNHFAFLLNGNLISTKMSGEAIDFLNALEQGLPIYY* |
| Ga0105249_105136941 | 3300009553 | Switchgrass Rhizosphere | KNDSCSHFAFMLNGKLMSTRMRNEAADFFDALERNMPFY* |
| Ga0105249_106016381 | 3300009553 | Switchgrass Rhizosphere | KGQKIQEVDFKMKDDSCNHFAFELNGKLMKTKMNSEAVDFLDALEKGMPYY* |
| Ga0105340_14024012 | 3300009610 | Soil | FYNKGQKIQEVDFKMKNDSCNHFFFLLNETRMSTKMSGEAIDFLNALEQGMPIYY* |
| Ga0126307_104940572 | 3300009789 | Serpentine Soil | NHFAFLLNGKLLNTKMSGEAIDFLNALEQGMPTYY* |
| Ga0126304_100676881 | 3300010037 | Serpentine Soil | TRGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMSGEAIDFLNALEQGMPIYY* |
| Ga0126306_113755061 | 3300010166 | Serpentine Soil | KNDSCNHFAFLLNGKLTSTKMSGEAIDFLNALEQGMPAYY* |
| Ga0134127_134761082 | 3300010399 | Terrestrial Soil | CNHFAFLLNGKLMSTKMSGEAVDFLDALEKGLPTYY* |
| Ga0134123_130452121 | 3300010403 | Terrestrial Soil | NDSCNHFTFLLKDKRIATKMSGEAVDFLDALEKGLPTYY* |
| Ga0105246_101813651 | 3300011119 | Miscanthus Rhizosphere | HFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0137348_10728821 | 3300011398 | Soil | KIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAVDFLNALEQGMPIYY* |
| Ga0137437_11587862 | 3300011442 | Soil | QKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAIDFLNALEQGMPTYY* |
| Ga0136631_103474773 | 3300012043 | Polar Desert Sand | LMMKDKTCRHFSFMLNNKLMSTKMNNEAVDFFPGLEEGRNWY* |
| Ga0157304_10262521 | 3300012882 | Soil | NKGQKIQEVDFKMKNDSCNHFAFLLDGKLMSTKMNSEAVDFLDALEKGMPVYY* |
| Ga0157287_10304341 | 3300012885 | Soil | NDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY* |
| Ga0157287_10970642 | 3300012885 | Soil | YTKGQKMQEVDFKMKNDSCNHFAFLLNGNLISTKMSGEAIDFLNALEQGMPIYY* |
| Ga0157284_100617321 | 3300012893 | Soil | CGYDGKMFFYHNGQEIQEVDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY* |
| Ga0157292_102172082 | 3300012900 | Soil | FYYKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY* |
| Ga0157291_100750491 | 3300012902 | Soil | YDGKMFFYAKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEQGMPYYY* |
| Ga0157289_100553071 | 3300012903 | Soil | DFKMKNDSCNHFFFLLNENRMSTKMSGEAIDFLNALEQGMPTYY* |
| Ga0157282_101983341 | 3300012904 | Soil | KMQEVDFKMKNDSCNHFFFLLNEIRMSTKMSGEAIDFLNALEQGMPIYY* |
| Ga0157295_103441132 | 3300012906 | Soil | KMKNDSCNHFAFLLNGKLLSTKMNNEAVDFLDALEKGLPTYY* |
| Ga0157283_100551632 | 3300012907 | Soil | FKMKDDSCNHFAFLLNGKLMSTEMNNEAVDFLDALEKGLPTYY* |
| Ga0157301_104187662 | 3300012911 | Soil | MKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPVYY* |
| Ga0157306_103074951 | 3300012912 | Soil | GQQMQEVDFKMKNDSCNHFAFLLNGKLMSTKMSGVAIDFLNALEQGMPTYY* |
| Ga0157298_100593322 | 3300012913 | Soil | NHFVFRLNGKLVRTKMNSEAVDFLDALEKGMPYY* |
| Ga0164309_115935262 | 3300012984 | Soil | DGKMFFYHKGEKIQEVDFKMKDDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY |
| Ga0157378_130232102 | 3300013297 | Miscanthus Rhizosphere | HFAFLVNGNLVSTKMSGEAIDFLNALEQGMPVYY* |
| Ga0157375_122581501 | 3300013308 | Miscanthus Rhizosphere | QEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0163163_124039411 | 3300014325 | Switchgrass Rhizosphere | EVDFKMKNDSCNHFAFLLNGKLLSTKMNNEAVDFLDALEKGLPTYY* |
| Ga0157380_119699202 | 3300014326 | Switchgrass Rhizosphere | MFFYDKGQKMQEVDFKMKNDSCNHFAFLLNGKLISTKMSGEAIDFLNALEQGMPIYY* |
| Ga0157376_122700512 | 3300014969 | Miscanthus Rhizosphere | CGDDGKMFFYHKGQKMQEVDFKMKDNSCNHFAFLVNEKLVTLKMSEEAIDFLDALEKGMPYY* |
| Ga0173480_103408802 | 3300015200 | Soil | YDGKMFFYHNGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY* |
| Ga0163161_113508071 | 3300017792 | Switchgrass Rhizosphere | DFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY |
| Ga0184611_10227233 | 3300018067 | Groundwater Sediment | DGKMFFYHNGQEIQEVDFKMKNDSCNHFVFRLNGNLVSTKMNSEAVDFLDALEKGMPYY |
| Ga0184627_104339572 | 3300018079 | Groundwater Sediment | KDDSCRHFSFLLNGKLTSTKMNNEAVDFLDALEKGMPYYW |
| Ga0190270_121563201 | 3300018469 | Soil | DFKMKIDSCRHFSFLLNGQLMSTKLNNEAADFLDALEKGLPVYW |
| Ga0173481_106186171 | 3300019356 | Soil | EIQEVDFKMKNDSCNHFVFKLNGNLVSTKMNNEAVDFLDALEKGLPTYY |
| Ga0173482_103241542 | 3300019361 | Soil | KNDSCNHFVFRLNGNLVSTKMNSEAIDFLDALEKGMPYY |
| Ga0173479_102002112 | 3300019362 | Soil | FKMKNDSCNHFAFLLNGTLTSTKMSGEAIDFLNALEQGMPAYY |
| Ga0193702_10071783 | 3300019871 | Soil | YHNGQEIQEVDFKMKNDSCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY |
| Ga0193740_10612492 | 3300020009 | Soil | FFYNKGQKIQEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAKDFLNALEQGMPIYY |
| Ga0193738_100004557 | 3300020020 | Soil | DDSCNHFSFLLNGKIMSTKINSEAVDFLDALEKGMPYYY |
| Ga0247746_10055244 | 3300022886 | Soil | KIQEVDFKMKNDSCNHFAFLLDGKLMSTKMNSEAVDFLDALEKGMPVYY |
| Ga0247766_10076064 | 3300022906 | Plant Litter | QEVDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY |
| Ga0247779_11869191 | 3300022908 | Plant Litter | KNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY |
| Ga0247801_10055731 | 3300023064 | Soil | KMKNDSCNHFVFRLNGNLVSTKMNSEAVDFLDALEKGMPYY |
| Ga0247751_10718411 | 3300023069 | Soil | NDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY |
| Ga0247752_10769332 | 3300023071 | Soil | NHFFFLLNENKVSTKMSGEAIDFLNALEQGMPTYY |
| Ga0247784_11100451 | 3300023270 | Plant Litter | EQGNCGNDGKMFFYYKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY |
| Ga0247794_100930451 | 3300024055 | Soil | SQKIQEVDFKMKNDSCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPTYY |
| Ga0207701_107563672 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | IQEVDFKMKNDSCNHFVFRLNGNLVRTKMNSEAVDFLDALEKGMPYY |
| Ga0207644_111176492 | 3300025931 | Switchgrass Rhizosphere | SCNHFAFLVNGNLMSTKMSGEAIDFLNALEQGMPTYY |
| Ga0207691_106589252 | 3300025940 | Miscanthus Rhizosphere | FFYHKGEKIQEVDFKMKDDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGLPTYY |
| Ga0207689_109816251 | 3300025942 | Miscanthus Rhizosphere | SKETKPFDCGYDGKMFFFKKGNKIQEVDFKTTNDSCNHFAFRLNDKLIRTRVSNEAVDFLNALEQGLPTYY |
| Ga0207679_110987251 | 3300025945 | Corn Rhizosphere | SCNHFAFLLNGKLMKTKMNSEAVDFLDALEKGLPTYY |
| Ga0207712_114559242 | 3300025961 | Switchgrass Rhizosphere | GQKIQEVDFKMKDDSCNHFAFELNGKLMKTKMNSEAVDFLDALEKGMPYY |
| Ga0207674_109867031 | 3300026116 | Corn Rhizosphere | DGKMFFYTKGQKIQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGMPTYY |
| Ga0209468_10832341 | 3300026306 | Soil | KIQEVDFKMKNDSCNHFSFLLNGKMISTKMNNEAVDFLDALEKGLPTYY |
| Ga0209996_10196822 | 3300027395 | Arabidopsis Thaliana Rhizosphere | QKIQEVDFKMKNDSCNHFFFLLNKNRMSTKMSGEAIDFLNALEQGMPTYY |
| Ga0209798_100148141 | 3300027843 | Wetland Sediment | SDDACNHFAFMLNGKLINTTMKNEAVDFFDALGKGLPFY |
| Ga0209486_100843281 | 3300027886 | Agricultural Soil | KGQKIQEVDFKMKDDSCNHFAFELSGKLVRTKMNSEAVDFLDALEKGMPYY |
| Ga0268265_114338702 | 3300028380 | Switchgrass Rhizosphere | QEVDFKMKNDSCNHFFFLLNENRMSTKMSGEAIDFLNALEQGMPVYY |
| Ga0310888_101308751 | 3300031538 | Soil | NHFAFLLNGNLMSTKMSGEAIDFLNALEQGMPIYY |
| Ga0310892_105698441 | 3300031858 | Soil | MFFYAKGQKLQEVDFKMKNDSCNHFAFLLNGKLMSTKMNNEAVDFLDALEKGMPTYY |
| Ga0310900_115457402 | 3300031908 | Soil | GKMFFYNKGQKIQEVDFKMKNDSCNHFALLVNGKLTGTKMSNEAIDFLNALEQGMPTYY |
| Ga0310884_103017421 | 3300031944 | Soil | KGQKIQEVDFKLKDDSCNHFAFFLNEKLVSTKMNSEAVDFLDALEKGLPTYY |
| Ga0310906_111039791 | 3300032013 | Soil | RCGYDGKMFFYHNGQEIQEVDFKMKNDSCNHFVFRLNGNLVSTKMNSEAIDFLDALEKGMPYY |
| Ga0315270_101755311 | 3300032275 | Sediment | QKFQEVDFKMKNDSCNHFAFLLNGKLTSTKMSNEAIDFLNALDQGLPIYY |
| ⦗Top⦘ |