| Basic Information | |
|---|---|
| Family ID | F099905 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | EQEALDFCEFQLGTIRDYMEPPGSPELEEAYQRYVTEPDVNR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.26 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.786 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.155 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01063 | Aminotran_4 | 5.83 |
| PF00916 | Sulfate_transp | 4.85 |
| PF00903 | Glyoxalase | 3.88 |
| PF13377 | Peripla_BP_3 | 3.88 |
| PF01614 | IclR | 2.91 |
| PF02687 | FtsX | 2.91 |
| PF03807 | F420_oxidored | 1.94 |
| PF10604 | Polyketide_cyc2 | 1.94 |
| PF08044 | DUF1707 | 1.94 |
| PF13407 | Peripla_BP_4 | 1.94 |
| PF01717 | Meth_synt_2 | 1.94 |
| PF00085 | Thioredoxin | 0.97 |
| PF00126 | HTH_1 | 0.97 |
| PF00884 | Sulfatase | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF12697 | Abhydrolase_6 | 0.97 |
| PF08240 | ADH_N | 0.97 |
| PF11706 | zf-CGNR | 0.97 |
| PF00296 | Bac_luciferase | 0.97 |
| PF03243 | MerB | 0.97 |
| PF00005 | ABC_tran | 0.97 |
| PF13515 | FUSC_2 | 0.97 |
| PF02628 | COX15-CtaA | 0.97 |
| PF08818 | DUF1801 | 0.97 |
| PF00578 | AhpC-TSA | 0.97 |
| PF12902 | Ferritin-like | 0.97 |
| PF07704 | PSK_trans_fac | 0.97 |
| PF09278 | MerR-DNA-bind | 0.97 |
| PF00196 | GerE | 0.97 |
| PF08223 | PaaX_C | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 11.65 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 4.85 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 4.85 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 4.85 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 2.91 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.94 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.97 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.97 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.97 |
| COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.97 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.97 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.97 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.79 % |
| Unclassified | root | N/A | 26.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12562519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300004082|Ga0062384_100106178 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300004091|Ga0062387_100535196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11 | 826 | Open in IMG/M |
| 3300004091|Ga0062387_101229794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300004635|Ga0062388_100963147 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005332|Ga0066388_101898182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1063 | Open in IMG/M |
| 3300005434|Ga0070709_11599623 | Not Available | 531 | Open in IMG/M |
| 3300005437|Ga0070710_10274535 | Not Available | 1091 | Open in IMG/M |
| 3300005468|Ga0070707_100050751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3977 | Open in IMG/M |
| 3300005591|Ga0070761_10812341 | Not Available | 589 | Open in IMG/M |
| 3300005842|Ga0068858_100504178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1169 | Open in IMG/M |
| 3300006163|Ga0070715_10760094 | Not Available | 585 | Open in IMG/M |
| 3300006163|Ga0070715_11098959 | Not Available | 501 | Open in IMG/M |
| 3300006174|Ga0075014_100773889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300006174|Ga0075014_100920702 | Not Available | 525 | Open in IMG/M |
| 3300006581|Ga0074048_12619544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300006755|Ga0079222_10056906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1850 | Open in IMG/M |
| 3300006806|Ga0079220_10475015 | Not Available | 845 | Open in IMG/M |
| 3300006806|Ga0079220_10589169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300006954|Ga0079219_12014013 | Not Available | 550 | Open in IMG/M |
| 3300009098|Ga0105245_10867213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
| 3300009101|Ga0105247_11841596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300009525|Ga0116220_10256168 | Not Available | 765 | Open in IMG/M |
| 3300009839|Ga0116223_10387888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300010358|Ga0126370_10669141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300010371|Ga0134125_11359567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300010373|Ga0134128_11614224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300010379|Ga0136449_102289173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 784 | Open in IMG/M |
| 3300010862|Ga0126348_1080915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300012176|Ga0153952_1079439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
| 3300012477|Ga0157336_1006112 | Not Available | 816 | Open in IMG/M |
| 3300012989|Ga0164305_10204473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1391 | Open in IMG/M |
| 3300013306|Ga0163162_11114542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
| 3300015373|Ga0132257_100521781 | Not Available | 1459 | Open in IMG/M |
| 3300015374|Ga0132255_101794958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
| 3300016294|Ga0182041_10054579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2726 | Open in IMG/M |
| 3300016319|Ga0182033_10246608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1449 | Open in IMG/M |
| 3300016357|Ga0182032_11857004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300016387|Ga0182040_10519655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 954 | Open in IMG/M |
| 3300016404|Ga0182037_11299435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 641 | Open in IMG/M |
| 3300016422|Ga0182039_12264200 | Not Available | 502 | Open in IMG/M |
| 3300017928|Ga0187806_1045338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris | 1328 | Open in IMG/M |
| 3300017939|Ga0187775_10541880 | Not Available | 500 | Open in IMG/M |
| 3300017942|Ga0187808_10425292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300017942|Ga0187808_10502279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300017973|Ga0187780_10914463 | Not Available | 637 | Open in IMG/M |
| 3300017974|Ga0187777_10527985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300017974|Ga0187777_10906334 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300017974|Ga0187777_11191447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 557 | Open in IMG/M |
| 3300018085|Ga0187772_10524306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 837 | Open in IMG/M |
| 3300018088|Ga0187771_11753813 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300019890|Ga0193728_1214238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300021088|Ga0210404_10677138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300021170|Ga0210400_10984836 | Not Available | 686 | Open in IMG/M |
| 3300021171|Ga0210405_10619830 | Not Available | 841 | Open in IMG/M |
| 3300021178|Ga0210408_10643773 | Not Available | 837 | Open in IMG/M |
| 3300021404|Ga0210389_10806124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300021474|Ga0210390_10515595 | Not Available | 1006 | Open in IMG/M |
| 3300021474|Ga0210390_11363056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300025927|Ga0207687_10095774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2174 | Open in IMG/M |
| 3300025929|Ga0207664_11993371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300026035|Ga0207703_11081843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300027775|Ga0209177_10405996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300027829|Ga0209773_10085824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
| 3300028875|Ga0307289_10027573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2222 | Open in IMG/M |
| 3300028885|Ga0307304_10067287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1367 | Open in IMG/M |
| 3300030743|Ga0265461_11079243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300031199|Ga0307495_10172418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 576 | Open in IMG/M |
| 3300031543|Ga0318516_10706551 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031543|Ga0318516_10844267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300031544|Ga0318534_10124246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
| 3300031544|Ga0318534_10560391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300031546|Ga0318538_10128575 | Not Available | 1328 | Open in IMG/M |
| 3300031561|Ga0318528_10702138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 541 | Open in IMG/M |
| 3300031680|Ga0318574_10057658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2061 | Open in IMG/M |
| 3300031680|Ga0318574_10841390 | Not Available | 537 | Open in IMG/M |
| 3300031718|Ga0307474_10008872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7255 | Open in IMG/M |
| 3300031736|Ga0318501_10603244 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031748|Ga0318492_10208818 | Not Available | 1001 | Open in IMG/M |
| 3300031751|Ga0318494_10104235 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300031764|Ga0318535_10212267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 866 | Open in IMG/M |
| 3300031771|Ga0318546_10750966 | Not Available | 687 | Open in IMG/M |
| 3300031779|Ga0318566_10184214 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300031779|Ga0318566_10540025 | Not Available | 570 | Open in IMG/M |
| 3300031796|Ga0318576_10431926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300031823|Ga0307478_10337301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300031890|Ga0306925_11171028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300031894|Ga0318522_10311814 | Not Available | 596 | Open in IMG/M |
| 3300031912|Ga0306921_10931642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300031942|Ga0310916_10488695 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031954|Ga0306926_12243456 | Not Available | 607 | Open in IMG/M |
| 3300032008|Ga0318562_10444583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 753 | Open in IMG/M |
| 3300032074|Ga0308173_12354978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300032076|Ga0306924_12203822 | Not Available | 562 | Open in IMG/M |
| 3300032089|Ga0318525_10089538 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300032089|Ga0318525_10384986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300032261|Ga0306920_100416188 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300032515|Ga0348332_13923331 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 647 | Open in IMG/M |
| 3300032828|Ga0335080_10177615 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2349 | Open in IMG/M |
| 3300032828|Ga0335080_11308535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300032897|Ga0335071_10072373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3382 | Open in IMG/M |
| 3300032898|Ga0335072_10645763 | Not Available | 1051 | Open in IMG/M |
| 3300033134|Ga0335073_10188945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_125625191 | 3300000789 | Soil | RELRTEEQEALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0062384_1001061783 | 3300004082 | Bog Forest Soil | YPAEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQLYVTEPDVNR* |
| Ga0062387_1005351962 | 3300004091 | Bog Forest Soil | KLYPAEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQLYVTEPDVNR* |
| Ga0062387_1012297941 | 3300004091 | Bog Forest Soil | KLYPAEQEALDFCEFQLETIRDYMEPPGSPELEEAYERYVIEPDVNR* |
| Ga0062388_1009631472 | 3300004635 | Bog Forest Soil | QAALDFCEFQLGTVHDLMEPPGSPELEEAYKRYVSEPDVSR* |
| Ga0066388_1018981822 | 3300005332 | Tropical Forest Soil | HHKLHPKQQEALDFCEFQLRTVRNYMEPPGSPELEEAYKRYVTELDVSR* |
| Ga0070709_115996231 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRELRTEEQDALDFCGFQLRTIGTYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0070710_102745351 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EQEALDFCEFQLGTIRDYMEPPGSPGLEEAYKLYVSEPDVNRCS* |
| Ga0070707_1000507511 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTEEQEALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0070761_108123411 | 3300005591 | Soil | LDFCAFQLGTVRDYMEPPGSAELEEAYRRYVHEPDVNR* |
| Ga0068858_1005041781 | 3300005842 | Switchgrass Rhizosphere | ELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0070715_107600942 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0070715_110989591 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0075014_1007738892 | 3300006174 | Watersheds | MNAPPELSAEEQAALDFCEFQLGTVRAYMESPGSAELEEAYQRY |
| Ga0075014_1009207021 | 3300006174 | Watersheds | CTEEQAALEFCEFQLTTIRDYMEPPGSPELEDAYQQYVGEPDVNR* |
| Ga0074048_126195443 | 3300006581 | Soil | RTEEQEALAFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0079222_100569061 | 3300006755 | Agricultural Soil | QEALDFCQFQLGTVHDYMEPPGSPELDEACKRYVSEPDVSR* |
| Ga0079220_104750153 | 3300006806 | Agricultural Soil | LHARQQEALDFCQFQLGTVHDYMEPPGSPELDEACKRYVSEPDVSR* |
| Ga0079220_105891691 | 3300006806 | Agricultural Soil | QEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0079219_120140132 | 3300006954 | Agricultural Soil | LDFCQFQLGTIRDYMEPPGSPELKEAYQRYVSDPDVNR* |
| Ga0105245_108672131 | 3300009098 | Miscanthus Rhizosphere | ELRTEEREALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0105247_118415962 | 3300009101 | Switchgrass Rhizosphere | EALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0116220_102561683 | 3300009525 | Peatlands Soil | CEFQLTTIRDYMEPPGSPELEEAYQRYVSEPDVNR* |
| Ga0116223_103878881 | 3300009839 | Peatlands Soil | LDFCEFQLGTVHNYMEPPGSPELEEAYRRYVSEPDVNR* |
| Ga0126370_106691411 | 3300010358 | Tropical Forest Soil | CTFQLGTVRDYMEPPGSPELDEAYERYVSEPDVSR* |
| Ga0134125_113595671 | 3300010371 | Terrestrial Soil | DMAHRAVLQSRLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0134128_116142241 | 3300010373 | Terrestrial Soil | EEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0136449_1022891732 | 3300010379 | Peatlands Soil | LYPAEREALDFCGFQLETIRDYMEPPGSPELEEAYKRCVSEPDVNR* |
| Ga0126348_10809151 | 3300010862 | Boreal Forest Soil | CEFQLGTIRDYMEPPGSPELEEAYKLYVRQPDVNR* |
| Ga0153952_10794391 | 3300012176 | Attine Ant Fungus Gardens | EQEALDFCEFQLGTIRDYMEPPGSPELEEAYQRYVTEPDVNR* |
| Ga0157336_10061121 | 3300012477 | Arabidopsis Rhizosphere | LAILQSHLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0164305_102044731 | 3300012989 | Soil | LRTEEQEALDFCGFQLRTIGAYMDPPGSPELEKAYQRYISEPDVNR* |
| Ga0163162_111145421 | 3300013306 | Switchgrass Rhizosphere | SHLRELRTEERDALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0132257_1005217814 | 3300015373 | Arabidopsis Rhizosphere | RTEEQEALDFCGFQLRTIGPYMEPPSSPELEKAYQRYISEPDVNR* |
| Ga0132255_1017949581 | 3300015374 | Arabidopsis Rhizosphere | LDFCRFQLRTTGAYMEPPGSPELEKAYQRYISEPDVNR* |
| Ga0182041_100545796 | 3300016294 | Soil | SAGEQEALDFCAFQLGTIRDYMEPPGSAELEEAYQRYVRDPDVNR |
| Ga0182033_102466081 | 3300016319 | Soil | KLRPSEQEALDFCDFQLGTIRDYMERPGSPELEEAYVRYVSEPDVSR |
| Ga0182032_118570042 | 3300016357 | Soil | CTFQLGTVRDYMEPPGSAELEEAYQRYVRDPDVNR |
| Ga0182040_105196551 | 3300016387 | Soil | REREALDFCAFQLGTVHDYMEPPGSPGLEEAYQRYVSEPDVNR |
| Ga0182037_112994352 | 3300016404 | Soil | RKLQAGQQEALEFCEFQLGTVHDYMEPPGSPELEGAYQRYVSGPDVDR |
| Ga0182039_122642002 | 3300016422 | Soil | GAAQQLHRRELRADEQAALDFCDFQLGTVHDYMEPPGSPELEQAYNRYVSEPDVNR |
| Ga0187806_10453381 | 3300017928 | Freshwater Sediment | QEALDFCEFQLGTVRHYMEPPGSPELEEAYPRYVSEPDVNR |
| Ga0187775_105418801 | 3300017939 | Tropical Peatland | QKRAEEQAALDFCGFQLGTVHDYMEPPGSPELEEAYRRYVSEPDVSR |
| Ga0187808_104252921 | 3300017942 | Freshwater Sediment | LDFCEFQLGTVHDYMEPPGSPELEEAYRRYVSEPDVNR |
| Ga0187808_105022792 | 3300017942 | Freshwater Sediment | EQEALDFCEFQLGTVRDYMEPPGSPELEEAYELYVTEPDVNR |
| Ga0187780_109144631 | 3300017973 | Tropical Peatland | FCEFQLGTVHDYMEPPGSPELEEAYQRYVSDPDVNR |
| Ga0187777_105279851 | 3300017974 | Tropical Peatland | LHARQTEALDFCEFQLGTVHDYKEPPGSPELEEAYRRYVSEPDASR |
| Ga0187777_109063341 | 3300017974 | Tropical Peatland | LRAEEREALDFCDFQLGTVRDYMEPPGSPELEEAYQRHVSGPDVDR |
| Ga0187777_111914472 | 3300017974 | Tropical Peatland | ALDYCDFQLSTVRAYMEPPGSPALEGASRRYVTEPDVNR |
| Ga0187772_105243061 | 3300018085 | Tropical Peatland | HRHGREPSAEEQAALDFCDFQLSTVQDYMEPPGSPELERAYRRYVAEPDVNR |
| Ga0187771_117538131 | 3300018088 | Tropical Peatland | RHLHCRTLRTEEQAALDFCEFQLSTVHDYMEPPGSPELEEAYRRYVSEPDVNR |
| Ga0193728_12142383 | 3300019890 | Soil | MAHRAILQSHLRELRTEEQEALDFCRFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0210404_106771382 | 3300021088 | Soil | SHLRELGTEEQQALDFCEFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0210400_109848362 | 3300021170 | Soil | GRVLYPAEQEALDFCECQLETIRDYMEPPGSPELEEAYKLYVSEPDVNR |
| Ga0210405_106198302 | 3300021171 | Soil | PDGRELYPAEQEALDFCEFQLETIRDYMEPPGSPELEEAYKLYVSTPDVNR |
| Ga0210408_106437731 | 3300021178 | Soil | ELYPAEQEALDFCEFQLETIRDYMEPPGSPELEEAYKLYVSEPDVNR |
| Ga0210389_108061242 | 3300021404 | Soil | DFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0210390_105155951 | 3300021474 | Soil | LEFCAFQLKTIRDYMEPPGSPELEEAHRRYVSEPDVNR |
| Ga0210390_113630561 | 3300021474 | Soil | RRELCTQEQAALEFCEFQLRTMRDYMEPPGSPELEEAYQRYVSGPDVNR |
| Ga0207687_100957744 | 3300025927 | Miscanthus Rhizosphere | RTEERDALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0207664_119933711 | 3300025929 | Agricultural Soil | ELRTEEQEALDFCGFQLRTIGAYMEPPGSPDLEKAYQRYISEPDVNR |
| Ga0207703_110818432 | 3300026035 | Switchgrass Rhizosphere | RLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0209177_104059961 | 3300027775 | Agricultural Soil | LRTEEQEALDFCRFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0209773_100858243 | 3300027829 | Bog Forest Soil | ALDFCEFQLGTIRDYMEPPGSPELEEAYKLYVSGPDVNR |
| Ga0307289_100275734 | 3300028875 | Soil | SHLRELRTEEREALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0307304_100672871 | 3300028885 | Soil | ALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0265461_110792433 | 3300030743 | Soil | TEKQAALEFCTFQLKTIRDYMEPPGSPELEEAHRRYVSEPDVNR |
| Ga0307495_101724181 | 3300031199 | Soil | FCAFQLGTVRDYMEAPGSAELEEAYQRYVHEPDVNR |
| Ga0318516_107065511 | 3300031543 | Soil | LRAEEREALDFCDFQLGTVGDYMEPPGSPELEEAYQRYVGEPDVNR |
| Ga0318516_108442672 | 3300031543 | Soil | LDFCAFQLGTVHHYMEPPGSPELAEAYQRYVSDPDVNR |
| Ga0318534_101242461 | 3300031544 | Soil | FCEFQLGTIRNYMEPPGSPELEEAYVRFVREPDVNR |
| Ga0318534_105603912 | 3300031544 | Soil | EREALDFCAFQLGTVHDYMEPPGSPELEEAYQRYVSEPDVNR |
| Ga0318538_101285753 | 3300031546 | Soil | RGAAQQLHRRELRADEQAALDFCDFQLGTVHDYMEPPGSPELEQAYNRYVSEPDVNR |
| Ga0318528_107021382 | 3300031561 | Soil | RELRAEEREALDFCDFQLGTVRDYMEPPGSPELEGAYQRYVSGPDVDR |
| Ga0318574_100576583 | 3300031680 | Soil | SEQEALDFCEFQLGTIRNYMEPPGSPELEEAYVRFVREPDVNR |
| Ga0318574_108413901 | 3300031680 | Soil | DFCEFQLGTIRDYMEPPGSPELEEAYSRYVSEPDVNR |
| Ga0307474_1000887212 | 3300031718 | Hardwood Forest Soil | PAEQEALDFCEFQLGTIRDYMEAPGSPELEEAYKRYISNPDVNR |
| Ga0318501_106032441 | 3300031736 | Soil | LDFCDFQLGTVGDYMEPPGSPELEEAYQRYVGEPDVNR |
| Ga0318492_102088183 | 3300031748 | Soil | ALDFCEFQLGTVHDYMEPPDSPELEEAYKRYVSEPDVNR |
| Ga0318494_101042356 | 3300031751 | Soil | LVCFLQLGTVHDYMEPPDSPELEEAYKRYVSEPDVNR |
| Ga0318535_102122672 | 3300031764 | Soil | RQLHRRELRAEEREALGFCDFQLGTVRDYMEPPGSPELEGAYQRYVSGPDVDR |
| Ga0318546_107509662 | 3300031771 | Soil | FCKFQLGTIRDYMEPPGSAGLKEAYQRYVSDPDVNR |
| Ga0318566_101842141 | 3300031779 | Soil | DFCEFQLGTIRNYMEPPGSPELEEAYARFVSEPDVNR |
| Ga0318566_105400251 | 3300031779 | Soil | EALEFCEFQLGTVRDYMEPPGSPELEEAYVRYVSEPDVNR |
| Ga0318576_104319261 | 3300031796 | Soil | TLHAREQEALDFCTFQLGTVRDYMEPPGSAELEEAYQRYVRDPDVNR |
| Ga0307478_103373011 | 3300031823 | Hardwood Forest Soil | YPAEQEALDFCEFQLGTIRDYMEPPGSPELEEAYQRYVTEPDVNR |
| Ga0306925_111710281 | 3300031890 | Soil | PREQEALDFCKFQLGTIRDYMEPPGSAELEEAYQRYVRDPDVNR |
| Ga0318522_103118141 | 3300031894 | Soil | DFCDFQLGTVHDYMEPPGSPELEQAYNRYVSEPDVNR |
| Ga0306921_109316421 | 3300031912 | Soil | FCEFQLGTVRDYMEPPGSPELEEAYVRYVSEPDVNR |
| Ga0310916_104886953 | 3300031942 | Soil | LHRGELRAEEREALDFCDFQLGTVGDYMEPPGSPELEEAYQRYVGEPDVNR |
| Ga0306926_122434561 | 3300031954 | Soil | DFCEFQLGTIRDYMEPPGSPELEEAYVRSVGEPDVNR |
| Ga0318562_104445832 | 3300032008 | Soil | LHAGQQEALDFCESQLGTVHDYMEPPGSPELEEAHKRYVWEPDVNRFCDPA |
| Ga0308173_123549781 | 3300032074 | Soil | VAHRAVLQSRLRELRTEEQEALDFCGFQLRTIGAYMEPPGSPELEKAYQRYISEPDVNR |
| Ga0306924_122038222 | 3300032076 | Soil | CAYQLGTIRDYMEPPGSAELEEAYQRYVSDPDVNR |
| Ga0318525_100895381 | 3300032089 | Soil | PRHQEALDFCEFQLGTVHDYMEPPDSPELEEAYKRYVSEPDVNR |
| Ga0318525_103849862 | 3300032089 | Soil | REREALDFCAFQLGTVHDYMEPPGSPELEEAYQRYVSEPDVNR |
| Ga0306920_1004161884 | 3300032261 | Soil | DQARQAVWQLHRRELRAEEREALGFCDFQLGTVRDYMEPPGSPELEGAYQRYVSGPDVDR |
| Ga0348332_139233312 | 3300032515 | Plant Litter | WTLYPAEQEALDFCEFQLGTIREYMEPPGSPELEEAYKLYVSEPDVNR |
| Ga0335080_101776152 | 3300032828 | Soil | EALDFCKFQLGTIRDYMEPPGSAELKEAYQRYVSDPDVNR |
| Ga0335080_113085351 | 3300032828 | Soil | RAREQEALDFCEFQLGTIRDYMEPPGSPELKEAYQRYVTDPDVNR |
| Ga0335071_100723734 | 3300032897 | Soil | HRRTLHASEQEALDFCTFQLQTVRDYMEPPGSAELEEAYKRYVRDPDVNR |
| Ga0335072_106457631 | 3300032898 | Soil | LDFCGFQLRTIGAYMEPPGSPELEKAYERYISEPDVNR |
| Ga0335073_101889453 | 3300033134 | Soil | RELYTEEEEAADFCEFQLRTIGAYMEPPGSPELEKAYERYISEPDVNR |
| ⦗Top⦘ |