| Basic Information | |
|---|---|
| Family ID | F099896 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MEYAVTAGFLLAVVAGSFAAVILGGYGIAHLIASAL |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.50 % |
| % of genes near scaffold ends (potentially truncated) | 10.68 % |
| % of genes from short scaffolds (< 2000 bps) | 93.20 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.990 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.184 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (75.728 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13673 | Acetyltransf_10 | 2.91 |
| PF09933 | DUF2165 | 2.91 |
| PF06309 | Torsin | 1.94 |
| PF03466 | LysR_substrate | 0.97 |
| PF14087 | DUF4267 | 0.97 |
| PF01370 | Epimerase | 0.97 |
| PF01068 | DNA_ligase_A_M | 0.97 |
| PF03636 | Glyco_hydro_65N | 0.97 |
| PF12844 | HTH_19 | 0.97 |
| PF13358 | DDE_3 | 0.97 |
| PF05559 | DUF763 | 0.97 |
| PF02796 | HTH_7 | 0.97 |
| PF01381 | HTH_3 | 0.97 |
| PF06146 | PsiE | 0.97 |
| PF07995 | GSDH | 0.97 |
| PF14850 | Pro_dh-DNA_bdg | 0.97 |
| PF00589 | Phage_integrase | 0.97 |
| PF13565 | HTH_32 | 0.97 |
| PF13180 | PDZ_2 | 0.97 |
| PF13586 | DDE_Tnp_1_2 | 0.97 |
| PF16576 | HlyD_D23 | 0.97 |
| PF00816 | Histone_HNS | 0.97 |
| PF01436 | NHL | 0.97 |
| PF00582 | Usp | 0.97 |
| PF13408 | Zn_ribbon_recom | 0.97 |
| PF03401 | TctC | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 0.97 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.97 |
| COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.97 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.97 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.97 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.97 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.97 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.99 % |
| All Organisms | root | All Organisms | 33.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.94% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.97% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_00100470 | 2140918007 | Soil | MEYAITAAFLLAVVAGSFAAVILGGYGIVHLIASAL |
| F62_08456520 | 2170459010 | Grass Soil | MEYTITAAFLLAVVAGSIAAVILGGYGIAHLIASAL |
| INPhiseqgaiiFebDRAFT_1037672112 | 3300000364 | Soil | MQYVVTAAFLLAIVATSFAAVILGGYGIARLIALAL* |
| JGIcombinedJ26739_1003433363 | 3300002245 | Forest Soil | MEYVITAAFLLAVVAGSFAAVILGGYGFAHLIASAL* |
| Ga0062384_1003517372 | 3300004082 | Bog Forest Soil | LSERIRLMEYTVTAAFLLAVVAGSFAAVILGGYGIAQLIASAL* |
| Ga0062388_1025924272 | 3300004635 | Bog Forest Soil | VSAGGIFLIERIRPMEYSVTAAFLLAVVAGSFAAVIIGGYSIAQLIASAL* |
| Ga0070761_101075831 | 3300005591 | Soil | MEYAITAAFLLAVVAGSFAAVILGGYGIAQLIVSAL* |
| Ga0070761_110062911 | 3300005591 | Soil | MEYAVTAAFLLSVVAGSFAAVILGGYGIAQLIASAL* |
| Ga0066903_1028759593 | 3300005764 | Tropical Forest Soil | MQYAITAGFLLAVVAGGFAAVILAGYGIAHLIASGM* |
| Ga0066903_1042005331 | 3300005764 | Tropical Forest Soil | MQYDVTAAFLLAIVAGSFAAVILGGYEIALLIALAL* |
| Ga0066903_1068131882 | 3300005764 | Tropical Forest Soil | MCVQGLASPMEYTVITAFLLAGVAGSFAAVILGGYEIVCLIAFVL* |
| Ga0070766_104692443 | 3300005921 | Soil | MQYAITSAFLLAVVAGSFAAVILGVYGVAQLIASAL* |
| Ga0070766_111163862 | 3300005921 | Soil | MEYAVTAGFILAVVAGSFAVVILGGYEIAHLIAFAL* |
| Ga0066790_101554541 | 3300005995 | Soil | MEYAITTAFLLAVVAGSFAAVILGGYGVAQLIASAL* |
| Ga0066790_102704252 | 3300005995 | Soil | MEYAITAAFLLAVVAGSFAAIILGGYGVAQLIVSAL* |
| Ga0070717_109248532 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSPLTAAFLLAIVAGSFAAVILGGYEIARLIALAL* |
| Ga0070715_110538993 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYAITAAFLLAVVAGSFAAVILGGYGVAQLIAFAL* |
| Ga0070712_1008238612 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQYAVTAAFLLAIVAGSFAAVILSGYGIARLVALAM* |
| Ga0070712_1016995181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQYVVTAALLLAVVAGSFAAVILGGYGIARLIALAL* |
| Ga0070765_1014392011 | 3300006176 | Soil | MEYVATAAFLLSVVAGSFAAVIFGGYGIAQLIASAL* |
| Ga0105247_111870663 | 3300009101 | Switchgrass Rhizosphere | VEYTVTAAFLLAVVAGSFTVVIFGGYELVQLIASAL* |
| Ga0099796_105144581 | 3300010159 | Vadose Zone Soil | PAFPFLKVFPMQYAITVGFLLAVVAGSFAAVILGGYGIARLIAFAL* |
| Ga0126376_117316511 | 3300010359 | Tropical Forest Soil | MTESFMEYTITAAFLLAVVAGSFAAVILGGYGIAHLIASVL* |
| Ga0126379_120204522 | 3300010366 | Tropical Forest Soil | MEYTVIAAFLLAVVAGSFAAVILGGYEIARLIAFVL* |
| Ga0136449_1001950494 | 3300010379 | Peatlands Soil | MEYAVTAGFLLAVVAGSFAAVILGGYGIAHLIASAL* |
| Ga0136449_1002506123 | 3300010379 | Peatlands Soil | MEYAITAAFLLAVVAGSFAAVILGGYGVAQLIASAL* |
| Ga0136449_1046803122 | 3300010379 | Peatlands Soil | MEYAITAAFLLAVVAGSFAEVILGGYGVAQLIASAL* |
| Ga0150985_1146349421 | 3300012212 | Avena Fatua Rhizosphere | MEYTVTAGFLLAVVAGSFAAVILTGYGIARLVALAM* |
| Ga0137360_115245922 | 3300012361 | Vadose Zone Soil | MEYAVTAGFLLAVVAGSFAAVILGSYGIAHLIALAL* |
| Ga0126369_121302692 | 3300012971 | Tropical Forest Soil | PMEYTVITAFLLAGVAGSFAAVILGGYEIVCLIAFVL* |
| Ga0126369_131589852 | 3300012971 | Tropical Forest Soil | MQYAVTAAFLLAVVAGSFAALILGGYEIARLIAFAL* |
| Ga0182024_107388801 | 3300014501 | Permafrost | MEYAITAAFLLAVVAGSFAAVILAGYGVAQLIVSAL* |
| Ga0182024_109523772 | 3300014501 | Permafrost | MEYAITAAFLLAVVAGSFAAIVLGGYGVAQLIASAL |
| Ga0182036_115995671 | 3300016270 | Soil | MCGAGLASPMEYTVIAAFLLAVVAGSFAAVILGGYEIVRLIAFVL |
| Ga0182041_107658322 | 3300016294 | Soil | MQYAVTAAFLLAIVAGSFAVVILGGYEIARLIALGL |
| Ga0182033_108822411 | 3300016319 | Soil | MQYALTAAFLLAVVAGSFAAVILGGYEIARLIALAL |
| Ga0182033_113986251 | 3300016319 | Soil | MEYAVTAAFLLAVVTGSFVAVILGGYKIVHLIGLAL |
| Ga0182032_117944282 | 3300016357 | Soil | MEYAVTAAFLLAVVAGSFAAVILGGYEIAHLIALAL |
| Ga0182034_117390822 | 3300016371 | Soil | MEYTVIAAFLLAVVAGSFAAVILGGYEIVRLIAFVLYRRPTRLQT |
| Ga0182040_110769041 | 3300016387 | Soil | MQYFITAAFLLAVVAGSFAAVVLGGYGIARLIAFAL |
| Ga0182037_117282472 | 3300016404 | Soil | MQYALTAAFLLAVVAGSFAAVILGGYGIVHLIASAL |
| Ga0182039_112581441 | 3300016422 | Soil | MQYVITAAFLLAVVAGSFAAVVLGGYGIARLIAFAL |
| Ga0182038_109671851 | 3300016445 | Soil | MEYAVTAGFLLAVVAGSFAAVILGGYGIVHLIASAL |
| Ga0182038_117488421 | 3300016445 | Soil | MQYVITAAFLLAVVAGSFAAVILGGYGIARLIAFAL |
| Ga0187879_105201062 | 3300017946 | Peatland | MEYAITAAFLLALVAGSFAAVILGGYGVAQLIVSAL |
| Ga0187772_102525451 | 3300018085 | Tropical Peatland | VEYTVTAAFLLAVVAGGFAAVILGGYGLVQLIAYAF |
| Ga0210407_108442701 | 3300020579 | Soil | MCGAGLASPMEYAVIAAFLLAVVAGSFAAVILGGYEMARLIAFVL |
| Ga0210384_107199012 | 3300021432 | Soil | MQYAITAGFLLAVVAGSFAAVILGGYGIACLIAFAL |
| Ga0210402_100425084 | 3300021478 | Soil | MEYTITAAFLLAVVAGGFAAVILGGYGIAHLIASAL |
| Ga0210402_105282771 | 3300021478 | Soil | MEYAVTAAFLLTVVAGSFAAVIFGGYEIAHLIALAL |
| Ga0210402_107076302 | 3300021478 | Soil | MEYAVTPGFLLAVVAGSFATVILVGYGIAHLIAFAL |
| Ga0210402_108008251 | 3300021478 | Soil | MEYAVTAAFLLSVVAGSFAAVILGGYGIAQLIASAL |
| Ga0210402_108305982 | 3300021478 | Soil | MQYAITAGFLLAVVAGSFAAVILGGFGIARLIALAL |
| Ga0210402_112716042 | 3300021478 | Soil | MEYTITAAFLLSVVAGSFAAVILGGYGIVHLIASVL |
| Ga0210402_114285582 | 3300021478 | Soil | MEYAVTAGFLLAVVAGSFATVILVGYEIAHLIAFAL |
| Ga0210402_115702521 | 3300021478 | Soil | MQYAITAAFLLAVVAGSFAAVILGGYGIARLIAFAL |
| Ga0210402_116013452 | 3300021478 | Soil | MEYTITAAFLLAVVAGIAAVILGGYGIAHLIVSAL |
| Ga0242665_102671261 | 3300022724 | Soil | MQYAITAAFLLAVVAGSFAAVILGGYGIVHLIASAL |
| Ga0242654_102588302 | 3300022726 | Soil | MEYAVTAGFLLAVVAGSFAAVIFGGYEIAHLVAFVL |
| Ga0207693_101637081 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQYVVTAAFLLAVVADSFAAVILGGYGIACLIAFAL |
| Ga0207693_105715811 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQYVVTAALLLAVVAGSFAAVILGGYGIARLIALAL |
| Ga0209447_102097352 | 3300027701 | Bog Forest Soil | MEYTITAAFLLAVVAGSFAVVIIGGYGIAQMIASAL |
| Ga0209655_101846111 | 3300027767 | Bog Forest Soil | MEYTVTAAFLLAVVAGSFAVVIIGGYGIAQMIASAL |
| Ga0209380_100841912 | 3300027889 | Soil | MEYAVTAGFILAVVAGSFAVVILGGYEIAHLIAFAL |
| Ga0209624_103438792 | 3300027895 | Forest Soil | MQYAITSAFLLAVVAGSFAAVILGVYGVAQLIASAL |
| Ga0209488_104423611 | 3300027903 | Vadose Zone Soil | MEYAITAAFLLAVVAGSFAAVIIGGYGVAQLIASAL |
| Ga0209006_100185383 | 3300027908 | Forest Soil | MEYTITAAFLLAVVTGSFATVILGGYGLAQLIASAL |
| Ga0209006_100293781 | 3300027908 | Forest Soil | MEYVATAAFLLSVVAGSFAAVIFGGYGIAQLIASAL |
| Ga0302225_104221151 | 3300028780 | Palsa | MEYAITTAFLLAVVAGSFAAVILSGYGVARLIASAL |
| Ga0311336_113336512 | 3300029990 | Fen | MEYAVTSGFLLAVVAGSFAAVIFAGYGIVHLLASA |
| Ga0302323_1014689121 | 3300031232 | Fen | MEYAVTSGFLLAVVAGSFAAVIFAGYGIVHLLASAL |
| Ga0318516_102024042 | 3300031543 | Soil | MEYTVIATFLLAVVTGSFAAVILGGYEIARLIAFVL |
| Ga0310915_109400931 | 3300031573 | Soil | MCGAGLASPMEYTVIAAFLLAVVAGSFAAVILGGYEMA |
| Ga0310686_1060693192 | 3300031708 | Soil | MEYAITAAFLLAVVAGSFAAVILGGYGVAHFIVSAL |
| Ga0306918_104931621 | 3300031744 | Soil | MQYAVTAALLLAIVTGSFAVVILGGYEIARLIALAL |
| Ga0318492_101798702 | 3300031748 | Soil | LFQDCTAAFLLAVVAGSFAAVILGGYGIARLIAFAL |
| Ga0318509_102534581 | 3300031768 | Soil | MCVQGLASPMEYTVITAFLLAGVAGSFAAVILGGHEIVCLIAFVL |
| Ga0307478_114272853 | 3300031823 | Hardwood Forest Soil | SCLEGFPITAAFLLAVVAGSFAAVILGGYGVAQLIASAL |
| Ga0306919_102465192 | 3300031879 | Soil | MQYAVTAAFLLAIVAGSFAAVILGGYEIARLIALGL |
| Ga0306919_108509811 | 3300031879 | Soil | MEYTVIATFLLAGVAGSFAAAILGGYEIARLIAFVL |
| Ga0306925_108724591 | 3300031890 | Soil | MQYAVTAAFLLAIVAGSFAVVILGGYEIARLIALAL |
| Ga0306921_101694351 | 3300031912 | Soil | MEYAVTAGFLLAVVAGSFAAVILGGYGIVHLIVSAL |
| Ga0306921_106570201 | 3300031912 | Soil | MEYTVIAAFLLAVVAGSFAAVILGGYEIVRLIAFVL |
| Ga0306921_117008351 | 3300031912 | Soil | MCGAGLASPMEYTVIAAFLLAVVAGSFAAVILGGYEIARLIAFVL |
| Ga0306921_124375312 | 3300031912 | Soil | KGRAHCSGTAPMQYAVTAAFLLAVVAGSFAALILGGYEIARLIAFAL |
| Ga0310916_108294822 | 3300031942 | Soil | MEYTVTAGFLLAVVAGSFAAVILGGYGIAHLIASIL |
| Ga0310909_106446923 | 3300031947 | Soil | QGLTSPMEYTVIAAFLLAVVAGSFAAVILGGYEIARLIAFVL |
| Ga0310909_114360391 | 3300031947 | Soil | MEYTVTAGFLLAVVAGSFAAVILGGYGIVHLIASAL |
| Ga0306926_105923421 | 3300031954 | Soil | MQYAVTAAFLLAIVAGSFAAVILGGYEIARLIALAL |
| Ga0306926_106453742 | 3300031954 | Soil | MEYTLTAAFLLAVVAASFAAVILGGYGVAHLIASAL |
| Ga0306926_117350431 | 3300031954 | Soil | MCGAGLASPMEYTVIAAFLLAVVAGSFAAVILGGYEIARLITFVL |
| Ga0318545_103669902 | 3300032042 | Soil | MQYAITAGFLLAVVAGSFAAVILGGYGIARLITYAL |
| Ga0318514_105136072 | 3300032066 | Soil | PMEYTVIAAFLLAVVAGSFAAVILGGYEIARLIAFVL |
| Ga0311301_101723012 | 3300032160 | Peatlands Soil | MEYAVTAGFLLAVVAGSFAAVILGGYGIAHLIASAL |
| Ga0306920_1009370571 | 3300032261 | Soil | MEYTVITAFLLAGVAGSFAAVILGGQEIVCLIAFVL |
| Ga0306920_1016698781 | 3300032261 | Soil | MQYALTAAFLLAVVAGSFAAVILGGYGIARLIAFAL |
| Ga0306920_1023909481 | 3300032261 | Soil | MEYTITVAFLLAIVMGSFAAVILGGYGLAQLIAAAL |
| Ga0306920_1025761861 | 3300032261 | Soil | LRVFRMEYTVTAGFLLAVVAGSFAAVILGGYGIAHLIASIL |
| Ga0306920_1033713571 | 3300032261 | Soil | MQGLASPMEYTVIAAFLLTVVAGSFAAVILGGYEIARLIAFVL |
| Ga0306920_1044580541 | 3300032261 | Soil | RVYRMEYTVTAGFLLAVVAGSFAAVILGGYGIAHLIASIL |
| Ga0348332_121392401 | 3300032515 | Plant Litter | MEYAITAAFLLAVVAGSFAAVIVGGYGIAQLIVSAL |
| Ga0335081_118754911 | 3300032892 | Soil | MQYAITAAFLLAVVAGSFAAVILGGYGIVHLIATAL |
| Ga0310914_109159242 | 3300033289 | Soil | MEYTVIAAFLLAVVAGSFAAVILGGHEIVCLIAFVL |
| ⦗Top⦘ |