| Basic Information | |
|---|---|
| Family ID | F099767 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TLDLSEARKKRRPSNDAAQKLEIELANVEKANLVPEI |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.09 % |
| % of genes from short scaffolds (< 2000 bps) | 86.41 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.058 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.650 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.301 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.31% β-sheet: 0.00% Coil/Unstructured: 67.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF08529 | NusA_N | 64.08 |
| PF13184 | KH_5 | 17.48 |
| PF14520 | HHH_5 | 8.74 |
| PF04760 | IF2_N | 6.80 |
| PF02576 | RimP_N | 1.94 |
| PF11987 | IF-2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 1.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.06 % |
| Unclassified | root | N/A | 1.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004479|Ga0062595_102356531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300004601|Ga0068934_1223849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 505 | Open in IMG/M |
| 3300005356|Ga0070674_100585369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 941 | Open in IMG/M |
| 3300005440|Ga0070705_101348853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300005537|Ga0070730_10689541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 648 | Open in IMG/M |
| 3300005561|Ga0066699_11010071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005575|Ga0066702_11002636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300005587|Ga0066654_10670141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 579 | Open in IMG/M |
| 3300005602|Ga0070762_10226296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1154 | Open in IMG/M |
| 3300005607|Ga0070740_10203872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 827 | Open in IMG/M |
| 3300005712|Ga0070764_10035843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2512 | Open in IMG/M |
| 3300005952|Ga0080026_10060965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300005994|Ga0066789_10248926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300005995|Ga0066790_10528920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300006046|Ga0066652_100749302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300006050|Ga0075028_100756173 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006050|Ga0075028_100824380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 567 | Open in IMG/M |
| 3300006102|Ga0075015_100334594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 841 | Open in IMG/M |
| 3300006102|Ga0075015_100515089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 691 | Open in IMG/M |
| 3300006162|Ga0075030_100021701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5520 | Open in IMG/M |
| 3300006173|Ga0070716_100042736 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| 3300006175|Ga0070712_101354432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 621 | Open in IMG/M |
| 3300006358|Ga0068871_100763456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300007788|Ga0099795_10613380 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007982|Ga0102924_1306853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300009088|Ga0099830_11650412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300009792|Ga0126374_11043618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300009824|Ga0116219_10682173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300010046|Ga0126384_11857859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300010136|Ga0127447_1024365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300010322|Ga0134084_10003367 | All Organisms → cellular organisms → Bacteria | 3620 | Open in IMG/M |
| 3300010337|Ga0134062_10723721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010360|Ga0126372_10628945 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300010366|Ga0126379_11829546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300011271|Ga0137393_11170280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012198|Ga0137364_10407462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300012200|Ga0137382_10087798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2029 | Open in IMG/M |
| 3300012205|Ga0137362_10241393 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300012211|Ga0137377_10362211 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300012285|Ga0137370_10566787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300012356|Ga0137371_11390316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300012469|Ga0150984_111272208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300012532|Ga0137373_10570641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300012930|Ga0137407_12244066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300012961|Ga0164302_10694873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300013105|Ga0157369_10061243 | All Organisms → cellular organisms → Bacteria | 4058 | Open in IMG/M |
| 3300014969|Ga0157376_10405346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300015373|Ga0132257_100827495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300016422|Ga0182039_10408566 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300017970|Ga0187783_10898426 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300017999|Ga0187767_10332029 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300018001|Ga0187815_10152937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300018012|Ga0187810_10129363 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300018030|Ga0187869_10445457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300018086|Ga0187769_11229145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300019882|Ga0193713_1131543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300020004|Ga0193755_1023317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2049 | Open in IMG/M |
| 3300020076|Ga0206355_1030968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300020140|Ga0179590_1167970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300020582|Ga0210395_11360953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300020583|Ga0210401_11173491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300021088|Ga0210404_10394173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300021181|Ga0210388_10473322 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300021401|Ga0210393_10024965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4654 | Open in IMG/M |
| 3300021407|Ga0210383_10092292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2544 | Open in IMG/M |
| 3300021432|Ga0210384_11145515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300021478|Ga0210402_10782069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300023101|Ga0224557_1286411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300025898|Ga0207692_10745503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300025913|Ga0207695_10472384 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300025921|Ga0207652_10605845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300025928|Ga0207700_10279540 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300025928|Ga0207700_10414121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300025929|Ga0207664_11329280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300025936|Ga0207670_10771389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300025945|Ga0207679_11693574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300026291|Ga0209890_10098418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300026310|Ga0209239_1042805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2077 | Open in IMG/M |
| 3300026498|Ga0257156_1127329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300026532|Ga0209160_1052719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2336 | Open in IMG/M |
| 3300026537|Ga0209157_1160572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300027069|Ga0208859_1014127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300027737|Ga0209038_10167740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300027842|Ga0209580_10066653 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300027842|Ga0209580_10379452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300028807|Ga0307305_10328179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300028906|Ga0308309_10808453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300029984|Ga0311332_10850349 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300031057|Ga0170834_107164811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1615 | Open in IMG/M |
| 3300031231|Ga0170824_127373764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031715|Ga0307476_10776083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031716|Ga0310813_10023752 | All Organisms → cellular organisms → Bacteria | 4227 | Open in IMG/M |
| 3300031716|Ga0310813_10304293 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300031726|Ga0302321_100942034 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300031740|Ga0307468_100105280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1690 | Open in IMG/M |
| 3300031798|Ga0318523_10164558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300031945|Ga0310913_10680960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300031945|Ga0310913_11188298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300032160|Ga0311301_12328213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300032782|Ga0335082_10975933 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032892|Ga0335081_10423811 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004601 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068968_14038061 | 3300004474 | Peatlands Soil | FHEGRLTLEVSTSRKKARPGDAPPQTLEIELANVEKANLVPEISGGLSNWEI* |
| Ga0062595_1023565311 | 3300004479 | Soil | RLTLDLSEARKKKRPALDASQKVEIELANVEKANLVPEI* |
| Ga0068934_12238492 | 3300004601 | Peatlands Soil | FHEGRLTLEVSTSRKKARPGDAPPPTLEIELANVEKANLVPEI* |
| Ga0070674_1005853692 | 3300005356 | Miscanthus Rhizosphere | GRLTLDLNAARKKSRPEEGVAPKLEIDLKNVEKANLVPEI* |
| Ga0070705_1013488531 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDLSEARKKFRPRRTAGEAPAPHKLDIELANVEKANLVPEL*AF* |
| Ga0070730_106895412 | 3300005537 | Surface Soil | RFGAGTLTLDLAEARKKFRPKEGTAEKLEIELANVEKANLVPEI* |
| Ga0066699_110100712 | 3300005561 | Soil | GRLTLDLAEARRKFRPQEGAAQRLEIELANVEKANLVPDI* |
| Ga0066702_110026362 | 3300005575 | Soil | FESGRLVLDLTEARKKFRPKDTAAEKLEIELANVEKANLVPEI* |
| Ga0066654_106701411 | 3300005587 | Soil | NRLTLDISEARRKFAPKDGGESEQLEIELANIEKANLVPEI* |
| Ga0070762_102262961 | 3300005602 | Soil | LQSFHDGRLTLEVGATRKKARPHGAANHASPQTLEIELANVEKANLVPEI* |
| Ga0070740_102038722 | 3300005607 | Surface Soil | RLTLDISDARRKFRPKDAGETRKLEIELANIEKANLVPEI* |
| Ga0070764_100358431 | 3300005712 | Soil | DGRLTLEMGGSRKKARPHDPAPQTLEIELANVEKANLVPEI* |
| Ga0080026_100609651 | 3300005952 | Permafrost Soil | TIDVSSGRKKARPEETAAQELEVDLANVEKANLVPEF* |
| Ga0066789_102489262 | 3300005994 | Soil | GRLTLDLSTARKKFRPAGDASQKLDIEFANVEKANLVPEI* |
| Ga0066790_105289202 | 3300005995 | Soil | QDGRLTLDLSTARKKFRPAGDASQKLDIEFANVEKANLVPEI* |
| Ga0066652_1007493021 | 3300006046 | Soil | GRLTLDLAEARRNFRPRNAGEAPAPHKLEIDLTNVEKANLVPEI* |
| Ga0075028_1007561732 | 3300006050 | Watersheds | MSAARRKLRPKEGQAPKVEIELANVEKANLVPEI* |
| Ga0075028_1008243801 | 3300006050 | Watersheds | VLDLSTARKKHRPADGTSQKLEIELANVEKANLVPEI* |
| Ga0075015_1003345942 | 3300006102 | Watersheds | LTLNLGEARKKRRPETGTPQKLEIELANVEKANLVPEI* |
| Ga0075015_1005150891 | 3300006102 | Watersheds | LDLSPVKKKRRPEPGAAEKLEIDLANVEKANLVPEI* |
| Ga0075030_1000217017 | 3300006162 | Watersheds | KLSLDLSAARRKMRPKDGAASVEIELANVEKANLVPEI* |
| Ga0070716_1000427363 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLSAARKKRRPGEAATERLEIDFANVEKANLVPEI* |
| Ga0070712_1013544321 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EARRKFRPKQNGGGASAAQKLEIELANVEKANLVPEI* |
| Ga0068871_1007634562 | 3300006358 | Miscanthus Rhizosphere | RLTLDLNAARKKRRPEEGVAPKLEIDLKNVEKANLVPEI* |
| Ga0099795_106133801 | 3300007788 | Vadose Zone Soil | MSTARRKLRPKEGQAPKVEIELANVEKANLVPEI* |
| Ga0102924_13068532 | 3300007982 | Iron-Sulfur Acid Spring | LEVSTSRKKARSGEAPPQTLEIELANVEKANLVPEI* |
| Ga0099830_116504122 | 3300009088 | Vadose Zone Soil | DLNAARKKRRPEDGVAPKLEIDLKNVEKANLVPEI* |
| Ga0126374_110436182 | 3300009792 | Tropical Forest Soil | DLSTARKKFRPADASQQKLELDLANIEKANLVPEI* |
| Ga0116219_106821732 | 3300009824 | Peatlands Soil | LSTARKKFRPSDQAVQKLDIEFANVEKANLVPEI* |
| Ga0126384_118578592 | 3300010046 | Tropical Forest Soil | LDLASAGKKPKPHAEAPQRLEIELANLEKANLVPEI* |
| Ga0127447_10243652 | 3300010136 | Grasslands Soil | GRLTLDMSTARKKFRSDGEQRLEIDLANVEKANLVPEI* |
| Ga0134084_100033676 | 3300010322 | Grasslands Soil | KLESFQQGRLTLDVSTARNKFRRSNGEQRLEIDLANVEKANLVPEI* |
| Ga0134062_107237212 | 3300010337 | Grasslands Soil | LMLDLTSAKKKNRPGEAPEKLEFELSNVEKANLVPEI* |
| Ga0126372_106289452 | 3300010360 | Tropical Forest Soil | FEAGRLRLDLADARRKYRTEQGASEKLELELANVEKANLVPEF* |
| Ga0126379_118295461 | 3300010366 | Tropical Forest Soil | LSAARRKHRAAEDAPRKLELELANVEKANLVPEL* |
| Ga0136449_1040538352 | 3300010379 | Peatlands Soil | TLEVSTSRKKARPGDAPPQTLEIELANVEKANLVPEISGGLSNWEI* |
| Ga0137393_111702801 | 3300011271 | Vadose Zone Soil | LERFAAGRLTLDLSEARKKFRPRQQEIEKLEIELANVEKANLAPEI* |
| Ga0137364_104074621 | 3300012198 | Vadose Zone Soil | ESGRLTLDLAEARRNFRPRNAGEAPAPHKLEIDLTNVEKANLVPEI* |
| Ga0137382_100877983 | 3300012200 | Vadose Zone Soil | LEMNAARKKPRPGSAAPQKLEIELANVEKANLVPEI* |
| Ga0137362_102413931 | 3300012205 | Vadose Zone Soil | MSVARRKMRPKDGQAPKVEIELANVEKANLVPEI* |
| Ga0137377_103622112 | 3300012211 | Vadose Zone Soil | ESGRLTLDLAQARKKTRVSSDAPQKLEIELANLEKANLVPEI* |
| Ga0137370_105667872 | 3300012285 | Vadose Zone Soil | FESGRLTLDLAEARRKFRPRNAGEAPVPHKLEIDLTNVEKANLVPEI* |
| Ga0137371_113903162 | 3300012356 | Vadose Zone Soil | DLAEARRKFRPADGERKLEIELANVEKANLVPEI* |
| Ga0150984_1112722082 | 3300012469 | Avena Fatua Rhizosphere | RLTLDIAEARKKFRPKEGTAEKLEIELANVEKANLVPEI* |
| Ga0137373_105706412 | 3300012532 | Vadose Zone Soil | SGRLTLDLAEASRKHRPKQNAGGAPAPHKLEIELANVEKANLVPEI* |
| Ga0137407_122440661 | 3300012930 | Vadose Zone Soil | LESFENGKLVLDMSVARRKMRPKVGQSPKVEIELANVEKANLVPEI* |
| Ga0164302_106948732 | 3300012961 | Soil | LDLAEARRKFRPKKIAGEASALQKLEIELANVEKANLVPEI* |
| Ga0157369_100612431 | 3300013105 | Corn Rhizosphere | LATFEAGRLTLDLAEARKKFRPKEGAAEKLVIELANVEKANLVPEL* |
| Ga0157376_104053462 | 3300014969 | Miscanthus Rhizosphere | LTLDLNAARKKRRPEEGVAPKLEIDLKNVEKANLVPEI* |
| Ga0132257_1008274952 | 3300015373 | Arabidopsis Rhizosphere | TLDLSEARRKHRPVEGAPQKLELELANIEKANLVPEL* |
| Ga0182039_104085662 | 3300016422 | Soil | DLAAARKKFRPQPGMPEKLEIELANIERANLVPEI |
| Ga0187783_108984261 | 3300017970 | Tropical Peatland | LLLDLSAARRKMRPKDGSPSVEIDLANVEKANLVPEI |
| Ga0187767_103320291 | 3300017999 | Tropical Peatland | TLDLAAARKKKSRPGLPDQKLEIDLADVEKANLVPEI |
| Ga0187815_101529372 | 3300018001 | Freshwater Sediment | TLEMSTQRKKARPGDAPPQTLEIELANVEKANLVPEI |
| Ga0187810_101293631 | 3300018012 | Freshwater Sediment | KLLLDLSAARRKMRPKDGTASVEIDLGNVEKANLVPEI |
| Ga0187869_104454572 | 3300018030 | Peatland | LEVGASRKKARPSDPAPQTLEIELANVENANLVPEI |
| Ga0187769_112291451 | 3300018086 | Tropical Peatland | GKLSLDLSAARRKMRPKDGSQSVEIELANVDKANLVPEI |
| Ga0193713_11315431 | 3300019882 | Soil | TLDLSEARKKRRPSNDAAQKLEIELANVEKANLVPEI |
| Ga0193755_10233171 | 3300020004 | Soil | LDLSEARKKRRPSNDAAQKLEIELANVEKANLVPEI |
| Ga0206355_10309682 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLSEARRKHRPAEGAPRKLELELANVEKANLVPEL |
| Ga0179590_11679701 | 3300020140 | Vadose Zone Soil | DLSAARRKHRPAADAPQKLEIELANVEKANLVPEI |
| Ga0210395_113609532 | 3300020582 | Soil | EVSASRKKARPGDAPPQMLEIEFANVEKANLVPEI |
| Ga0210401_111734911 | 3300020583 | Soil | FHDGRLSLEVGGSRKKARPGDPGPQMLEIELANVEKANLVPEI |
| Ga0210404_103941731 | 3300021088 | Soil | REGRLILDLSEARKKRRPIPGTPQKLEIELANVEKANLVPEI |
| Ga0210388_104733221 | 3300021181 | Soil | QSFHDGRLTLAVGASKKKPRPGDAAPQTLEIEFANVEKANLVPEI |
| Ga0210393_100249651 | 3300021401 | Soil | RLTLEVGASRKKARPGDVAPQTLEIELANVENANLVPEI |
| Ga0210383_100922921 | 3300021407 | Soil | LTLEMGASRKKARPHDPAPQTLEIELANVEQANLVPEI |
| Ga0210384_111455151 | 3300021432 | Soil | LTLDLSEARRKHRPGAASPQKLEIDLANVEKANLVPEL |
| Ga0210402_107820691 | 3300021478 | Soil | REGRLTLEVSASKKKARPGDPAPQTLEIELANVEKANLVPEI |
| Ga0224557_12864111 | 3300023101 | Soil | FHAGRLTLELSASRKKARPGEAAAQTLEIELANVEKANLVPEI |
| Ga0207692_107455032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DLAEARKKFRPKESASQKLEIDLANVEKANLVPEI |
| Ga0207695_104723842 | 3300025913 | Corn Rhizosphere | ESGRLTLDLSEARRKHRPAEGEPRKLELELANVEKANLVPEL |
| Ga0207652_106058452 | 3300025921 | Corn Rhizosphere | RLTLDLNAARKKRRPEEGVVPKLEIDLKNVEKANLVPEI |
| Ga0207700_102795401 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLILDMSQARQKRRAAAAAPQKLEIQLSNVEKANLVPEI |
| Ga0207700_104141211 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EHGRLTLNLAEARKKNRPKSVSEQTVEIELANVEKANLVPEI |
| Ga0207664_113292801 | 3300025929 | Agricultural Soil | FGAGRLTLDLAEARKKFRPKEGTAEKLDIELANVEKANLVPEI |
| Ga0207670_107713892 | 3300025936 | Switchgrass Rhizosphere | LTLDLNAARKKRRPEEGVAPKLEIDLKNVEKANLVPEI |
| Ga0207679_116935741 | 3300025945 | Corn Rhizosphere | RLTLDMAEARKKFRPKESSVQKLEIELANVEKANLVPEI |
| Ga0209890_100984182 | 3300026291 | Soil | FQDGRLTLDLSTARKKFRPAGDASQKLDIEFANVEKANLVPEI |
| Ga0209239_10428051 | 3300026310 | Grasslands Soil | TIEMNAARKKPRLGGGSQKLEIELANVEKANLVPEI |
| Ga0257156_11273292 | 3300026498 | Soil | LDMSAARRKMRPKDGQAPKVEIELANVEKANLVPEI |
| Ga0209160_10527191 | 3300026532 | Soil | LDLSEARRKPRPGAGSSQKLEIDLANVEKANLVPEL |
| Ga0209157_11605721 | 3300026537 | Soil | LMLDLTSAKKKNRPGEAPEKLEFELSNVEKANLVPEI |
| Ga0208859_10141272 | 3300027069 | Forest Soil | ATRKKARPHEAAKHASPQTLEIELANVEKANLVPEI |
| Ga0209038_101677402 | 3300027737 | Bog Forest Soil | KFHEGRLTLEVGASRKKARPSDPAPQTLEIELANIEKANLVPEI |
| Ga0209580_100666532 | 3300027842 | Surface Soil | LDLSEARGKHRAAAGTAQKLEIELANVEKANLVPEI |
| Ga0209580_103794521 | 3300027842 | Surface Soil | LTLDLSEARRKHRPGAGSPQKLEIDLANVEKANLVPEL |
| Ga0307305_103281791 | 3300028807 | Soil | RLPLYLSAAKKKRRPGEAAGEKVEIDLANVEKANLVPEI |
| Ga0308309_108084531 | 3300028906 | Soil | GRLTLDLNVARKKRRSEESVAPKLEIDLKNVEKANLVPEI |
| Ga0311332_108503491 | 3300029984 | Fen | VLDLSVARHKLRPKEGQAPKVEIELANVEKANLVPEI |
| Ga0170834_1071648112 | 3300031057 | Forest Soil | LESFRDGRLTLDVSTARKKFRPADATTQKLEIELANVEHANLVPEI |
| Ga0170824_1273737641 | 3300031231 | Forest Soil | TLDITEARKKFRPNEGTAEKLEIELANVEKANLVPEI |
| Ga0307476_107760831 | 3300031715 | Hardwood Forest Soil | SFREGRLTLDLSEARGKRRAVAGTAQKLEIELANVEKANLVPEI |
| Ga0310813_100237521 | 3300031716 | Soil | VEPPRSKKKQKLAPAHGQFEIELANVERANLVPEI |
| Ga0310813_103042931 | 3300031716 | Soil | TLDLSEARRKHRPAEGAPRKLELELANVEKANLVPEL |
| Ga0302321_1009420342 | 3300031726 | Fen | SLESFENGKLVLDLSVARHKLRPKEGQAPKVEIELANVEKANLVPEI |
| Ga0307468_1001052801 | 3300031740 | Hardwood Forest Soil | RLTLDLNAARKKRRPEEGVAPKLEIDLKNVEKANLVPEI |
| Ga0318523_101645582 | 3300031798 | Soil | DLSVARRKHRPAEEAPQKLEIELANVEKANLVPEV |
| Ga0310913_106809601 | 3300031945 | Soil | NLAEARKKNRPKPGGDQKIEIDLANVEKANLVPEI |
| Ga0310913_111882982 | 3300031945 | Soil | QSIHEGRLRLELGASRKKKGRPEIGPQELEIELANVENANLVPEI |
| Ga0311301_123282132 | 3300032160 | Peatlands Soil | NAASATKKKGRPVNGSPQKLEIELANVEKANLVPEI |
| Ga0335082_109759332 | 3300032782 | Soil | SLERVENGQLVLDLSTARRKMRPKEGQAPKVEIELANVEKANLVPEI |
| Ga0335081_104238111 | 3300032892 | Soil | ARRKFRPKKKAGGAPAPHVLEIELANVEKANLVPEI |
| ⦗Top⦘ |