| Basic Information | |
|---|---|
| Family ID | F099725 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | IQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 7.77 % |
| % of genes from short scaffolds (< 2000 bps) | 6.80 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.204 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (8.738 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.359 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.631 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01676 | Metalloenzyme | 62.14 |
| PF06415 | iPGM_N | 5.83 |
| PF01381 | HTH_3 | 1.94 |
| PF07609 | DUF1572 | 0.97 |
| PF00528 | BPD_transp_1 | 0.97 |
| PF13683 | rve_3 | 0.97 |
| PF13185 | GAF_2 | 0.97 |
| PF02897 | Peptidase_S9_N | 0.97 |
| PF03952 | Enolase_N | 0.97 |
| PF07040 | DUF1326 | 0.97 |
| PF02310 | B12-binding | 0.97 |
| PF05163 | DinB | 0.97 |
| PF13426 | PAS_9 | 0.97 |
| PF07238 | PilZ | 0.97 |
| PF12704 | MacB_PCD | 0.97 |
| PF13551 | HTH_29 | 0.97 |
| PF02265 | S1-P1_nuclease | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0696 | Phosphoglycerate mutase (BPG-independent), AlkP superfamily | Carbohydrate transport and metabolism [G] | 5.83 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.97 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.97 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.20 % |
| All Organisms | root | All Organisms | 6.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300006052|Ga0075029_100342148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300011271|Ga0137393_11202899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300019786|Ga0182025_1087333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300021046|Ga0215015_10690495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300025922|Ga0207646_10084862 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300029943|Ga0311340_11053631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300033158|Ga0335077_10460515 | Not Available | 1353 | Open in IMG/M |
| 3300033826|Ga0334847_008426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_101263833 | 3300001686 | Soil | SRKAPDPKHAKDFSREDLHDLELIAGLLATAPAVIAN* |
| Ga0068966_12757471 | 3300004476 | Peatlands Soil | IQISRKALDAKFAQDFSREDLHDLELVAGLLATAPALIAN* |
| Ga0062388_1000438067 | 3300004635 | Bog Forest Soil | IQISRKALDARFAQDFSREDLHDLELAAEVLASSPAIMLN* |
| Ga0070709_117541121 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGVIQISRKALDPKFAQDFSREDLHDLELVAGLLATAPALMTN* |
| Ga0070714_1009582701 | 3300005435 | Agricultural Soil | VGVIQISRKGLDSKLAQDFSREDLHDLELVAGLLASAPAMRAN* |
| Ga0070713_1001252783 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DKKVIGVIQISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN* |
| Ga0070713_1014199892 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VIQISRKGLDPRFAQDFSREDLHDLELAAGLLATAPALMSN* |
| Ga0066687_101442152 | 3300005454 | Soil | IGHDKAVIGVIQISRKALDPKHAQDFSREDLHDLELIAGLLATAPAVIAN* |
| Ga0070735_103550022 | 3300005534 | Surface Soil | IQISRKGLDPKYAKDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0066698_101239041 | 3300005558 | Soil | RKGLDPRFAPDFSREDLHDLELAAGVLASSPVLLAN* |
| Ga0070761_103853101 | 3300005591 | Soil | RKGLDPKYAPDFSREDLHDLEIAAGLMATAPALMSN* |
| Ga0070762_101706431 | 3300005602 | Soil | VGVIQISRKALDARFAQDFSREDLHDLELAAGILASAPAIMLN* |
| Ga0070762_104101132 | 3300005602 | Soil | KALDAKFAQDFSREDLHDLELVAGLLATAPALMAN* |
| Ga0070764_110114302 | 3300005712 | Soil | GVIQISRKGLDSKLAQDFSREDLHDLELVAGLLATAPALLSS* |
| Ga0075297_10282621 | 3300005878 | Rice Paddy Soil | PDKAVVGVIQISRKAPDPKHAKDFSREDLHDLELVAGLLATAPAVIAN* |
| Ga0070717_101366533 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGVIQISRKGLDAKHAKDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0066651_104493622 | 3300006031 | Soil | QISRKAPDPKHAKDFSREDLHDLELIAGLLATAPAVIAN* |
| Ga0075029_1003421482 | 3300006052 | Watersheds | MDQGSNVVGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0075017_1004477083 | 3300006059 | Watersheds | NVVGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0075017_1005984881 | 3300006059 | Watersheds | IQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0075017_1008444592 | 3300006059 | Watersheds | VGVIQISRKGLDPRYAQDFSREDLHDLELAAGLLATAPALFAN* |
| Ga0070716_1012211881 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IQISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN* |
| Ga0075014_1006774181 | 3300006174 | Watersheds | DQGSNVVGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0070712_1019262182 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVIQISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAS* |
| Ga0070765_1006228391 | 3300006176 | Soil | GVIQISRKGLDPRFAQDFSREDLHDLELAAGLLATAPALLEN* |
| Ga0066659_112771412 | 3300006797 | Soil | VIQISRKGLDPRFAPDFSREDLHDLELAAGVLASSPVLLAN* |
| Ga0066709_1000298741 | 3300009137 | Grasslands Soil | DSNVLGVIQISRKGTDSRFAPDFSRDDLHDLETAAGVLASSPVLLES* |
| Ga0126373_112417461 | 3300010048 | Tropical Forest Soil | GLDPKLAQDFSREDLHDLELLTGLLATAPAVLTN* |
| Ga0105239_117739112 | 3300010375 | Corn Rhizosphere | AVVGVIQISRKAPDPKHAKDFSREDLHDLELIAGLLATAPAVIAN* |
| Ga0105239_124968202 | 3300010375 | Corn Rhizosphere | SRKALDPKHAQDFSREDLHDLELIAGLLATAPVITAN* |
| Ga0126381_1021472051 | 3300010376 | Tropical Forest Soil | VVGVIQISRKGLDPKLAQDFSREDLHDLELLAGLLATAPAVLTN* |
| Ga0138573_12859152 | 3300011089 | Peatlands Soil | VIQISRKALDAKFAQDFSREDLHDLELVAGLLATAPALIAN* |
| Ga0137392_114884402 | 3300011269 | Vadose Zone Soil | KVLDPKLAKDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0137393_112028992 | 3300011271 | Vadose Zone Soil | DRDLNVLGVIQISRKGLDSRFAQDFSREDLHDLELAAGVLATSPVLLDN* |
| Ga0137397_110741972 | 3300012685 | Vadose Zone Soil | EQNVVGVIQISRKGLDPRFAQDFSREDLHDLELAAGLLATAPALLAN* |
| Ga0137410_115867192 | 3300012944 | Vadose Zone Soil | GVIQISRKGVDSRFAPDFSREDLHDLELAAGVLASSPVLLSN* |
| Ga0164307_114759741 | 3300012987 | Soil | GLDPKFAQDFSREDLHDLELAAGLLATAPALMSN* |
| Ga0134079_107643672 | 3300014166 | Grasslands Soil | QISRKALDSKFAQDFSREDLHDLELVAGLLATAPALMAN* |
| Ga0181522_101825763 | 3300014657 | Bog | GVIQISRKALDARFAEDFSREDLHDLELAAEILASAPAIMLN* |
| Ga0182032_103349792 | 3300016357 | Soil | IQISRKALDPKFAQDFSREDLHDLELAAGLLATAPALMSN |
| Ga0187817_101339442 | 3300017955 | Freshwater Sediment | SRKGLDPKYAQDFSREDLHDLELAAGLLATAPALVEN |
| Ga0187817_108290161 | 3300017955 | Freshwater Sediment | KALDPKFAQDFSREDLHDLEVAAGLLSAAPALLEN |
| Ga0187781_114433141 | 3300017972 | Tropical Peatland | RKGLDPKFAQDFGREDLHDLEIVAGLLATAPALLNS |
| Ga0187875_104667021 | 3300018035 | Peatland | RKALDPKFAQDFSREDLHDLELVTGLLATAPALLAN |
| Ga0187784_102289272 | 3300018062 | Tropical Peatland | QVSRKGVDPRFAQDFSREDLHDLELVAGLLATAPALVSN |
| Ga0187770_103373904 | 3300018090 | Tropical Peatland | VIQISRKALDAKYAQDFSREDLHDLEVAAGLLATAPALMAN |
| Ga0187770_108336941 | 3300018090 | Tropical Peatland | IQISRKALDAKYAQDFSREDLHDLEVAAGLLATAPALLAN |
| Ga0187770_109383552 | 3300018090 | Tropical Peatland | ISRKGLDARFAQDFSRDDLHDLEVVAGLLATAPALLAN |
| Ga0066655_107812052 | 3300018431 | Grasslands Soil | IGVIQISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN |
| Ga0182025_10873332 | 3300019786 | Permafrost | DQDSSVLGVIQVSRKGLDPRFTQDFSREDLHDLELAAGLLATSPVLQA |
| Ga0210403_101357901 | 3300020580 | Soil | IQISRKGLDSKLGQDFSREDLHDLELAAGLLATAPALLTN |
| Ga0210403_109651212 | 3300020580 | Soil | VVGVIQISRKALDAKFAKDFSREDLHDLELAAGLIATAPALLAN |
| Ga0210403_114672792 | 3300020580 | Soil | AVVGVIQISRKALDSKFAQDFSREDLHDLELVAGLLATAPALMAN |
| Ga0215015_106904951 | 3300021046 | Soil | MDHDSNVIGVIQISRKGADSRFAPDFSRDDLHDLETAAGVLASSPVLLQS |
| Ga0210405_104819062 | 3300021171 | Soil | RKALDSKFAQDFSREDLHDLELVAGLLATAPALMAN |
| Ga0210388_115034682 | 3300021181 | Soil | ISRKGLDPRFAQDFSREDLHDLELAAGLLATAPALLEN |
| Ga0210391_109325482 | 3300021433 | Soil | KALDPRFAQDFSREDLHDLELAAGILCTAPALSAN |
| Ga0210391_112502671 | 3300021433 | Soil | ISRKALDARFAQDFSREDLHDLELAAEILASAPAIMLN |
| Ga0224560_1128182 | 3300023019 | Soil | QISRKALDAKFAQDFSREDLHDLELVAGLLATAPALLAN |
| Ga0224561_10048852 | 3300023030 | Soil | GVIQISRKALDARFAQDFSREDLHDLELAAGILASAPAIMLN |
| Ga0208820_11062012 | 3300025576 | Peatland | VGVIQISRKGLDPKYAQDFSREDLHDLEIVAGLLATAPALLAN |
| Ga0207692_103741812 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VIQISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN |
| Ga0207646_100848625 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IQISRKGADSRFAPDFSRDDLHDLETAAGVLASSPVLLQN |
| Ga0207646_105815331 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVGVIQISRKGLDPKSAKDFSREDLHDLELAAGLLATAPALMAN |
| Ga0207664_106345041 | 3300025929 | Agricultural Soil | VGVIQISRKGLDSKLAQDFSREDLHDLELVAGLLASAPAMRAN |
| Ga0207702_120431212 | 3300026078 | Corn Rhizosphere | ISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN |
| Ga0209474_103250841 | 3300026550 | Soil | SRKALDPKHAQDFSREDLHDLELIAGLLATAPAVIAN |
| Ga0208827_11926872 | 3300027641 | Peatlands Soil | GVIQISRKGLDSRFAQDFSREDLHDLELAAGLLATAPALLAN |
| Ga0209007_11543742 | 3300027652 | Forest Soil | SRKGLDPKYAPDFSREDLHDLEIAAGLMATAPALMSN |
| Ga0209626_11223561 | 3300027684 | Forest Soil | VGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLAGDGDASSI |
| Ga0209274_102065192 | 3300027853 | Soil | DSNVVGVIQVSRKGLDPKYAPDFSREDLHDLEIAAGLMATAPALMSN |
| Ga0209517_105768891 | 3300027854 | Peatlands Soil | RDSNVMGVIQISRKGLDSRFAQDFSREDLHDLELAAGVLASSPVLLEN |
| Ga0209283_101369015 | 3300027875 | Vadose Zone Soil | ISRKGLDSRFAQDFSREDLHDLELAAGVLATSPVLLDN |
| Ga0209169_106020331 | 3300027879 | Soil | GVIQISRKALDAKFAQDFSREDLHDLELAAGLLATAPALLAN |
| Ga0209590_104056692 | 3300027882 | Vadose Zone Soil | SRKGLDPRFAPDFSREDLHDLELAAGVLASSPVLLAN |
| Ga0209067_102557453 | 3300027898 | Watersheds | SNVVGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN |
| Ga0209698_105131502 | 3300027911 | Watersheds | NVVGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALLAN |
| Ga0209168_100926062 | 3300027986 | Surface Soil | ISRKGLDSRFAQDFSREDLHDLELAAGLLATAPALLES |
| Ga0209168_102457442 | 3300027986 | Surface Soil | IQISRKGLDPKYAKDFSREDLHDLELAAGLLATAPALLAN |
| Ga0265355_10169203 | 3300028036 | Rhizosphere | QISRKALDARFAPDFSREDLHDLELAAEILASAPAIMLN |
| Ga0265338_103427171 | 3300028800 | Rhizosphere | SRKGLDPKFAKDFSREDLHDLELAAGLLATAPALLAN |
| Ga0311340_110536311 | 3300029943 | Palsa | DQDGVVVGVIQISRKGLDSKYAQDFSREDLHDLELVAGLLATAPALLEN |
| Ga0311371_107575731 | 3300029951 | Palsa | RDSVVVGVIQISRKALDAKFAQDFSREDLHDLELAAGLLATAPALLEN |
| Ga0265340_102212061 | 3300031247 | Rhizosphere | DSAVVGVIQISRKGDDPSFAQDFSREDLHDLELIAGLLASAPALIAN |
| Ga0265331_102307942 | 3300031250 | Rhizosphere | VGVIQISRKGLDSKYAQDFSREDLHDLELAAGLLATAPALLEN |
| Ga0302326_126208491 | 3300031525 | Palsa | VLGVLQISRKGLDPRFAPDFSREDLHDLELAAGVLAGSPVLTN |
| Ga0307476_102156621 | 3300031715 | Hardwood Forest Soil | LVVVGVIQISRKGLDSKLAQDFSREDLHDLELVAGLLATAPALLAN |
| Ga0307476_103004572 | 3300031715 | Hardwood Forest Soil | RNSTVVGVIQISRKGLDPKLAKDFSREDLHDLELAAGLLATAPALLAN |
| Ga0308175_1000225377 | 3300031938 | Soil | DKKVIGVIQISRKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN |
| Ga0318540_104864941 | 3300032094 | Soil | SAVVGVIQISRKGLDPKFAQDFSREDLHDLELAAGLLATAPALMSN |
| Ga0307472_1012187852 | 3300032205 | Hardwood Forest Soil | ISRKALDPKFAQDFSREDLHDLELAAGLLATAPALMTN |
| Ga0335085_103783723 | 3300032770 | Soil | KGLDPKFAQDFSREDLHDLELAAGLLATAPALMAN |
| Ga0335080_100478455 | 3300032828 | Soil | KGLDPKFAQDFSREDLHDLELVAGLLATAPALMQN |
| Ga0335081_109729392 | 3300032892 | Soil | VVGVIQISRKGLDARFAQDFSRDDLHDLEIVAGLLSTAPALMAN |
| Ga0335069_105900241 | 3300032893 | Soil | IQISRKGLDPKFAQDFSREDLHDLELVAGLLATAPALMSN |
| Ga0335074_101714381 | 3300032895 | Soil | TVVGVIQISRKGLDPKYAQDFSREDLHDLEIAAGLIATAPALLAN |
| Ga0335076_106286212 | 3300032955 | Soil | RASSVVGVIQISRKGLDPKLAQDFSREDLHDLELVAGLLATAPAVIAN |
| Ga0335073_101170231 | 3300033134 | Soil | VGVIQISRKGLDPKYAHDFSREDLHDLEIAAGLIATAPALLEN |
| Ga0335077_104605152 | 3300033158 | Soil | MDKGTAVVGVIQISRKGLDARFAQDFSRDDLHDLEIVAGLLATAPALLAN |
| Ga0326728_101851723 | 3300033402 | Peat Soil | KGLDARFAQDFSREDLHDLEVVAGLLATAPALLAN |
| Ga0310810_113628922 | 3300033412 | Soil | RKALDPKQAHDFSREDLHDLELIAGLLATAPVITAN |
| Ga0334847_008426_908_1060 | 3300033826 | Soil | MDRDSVVVGVIQISRKGLDSRFAQDFSREDLHDLELAAGLLATAPALLAN |
| Ga0334790_001153_22633_22743 | 3300033887 | Soil | RKALDSKFAQDFSREDLHDLELAAGLLATAPALLTN |
| ⦗Top⦘ |