| Basic Information | |
|---|---|
| Family ID | F099704 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPDQTNAWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Number of Associated Samples | 60 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 32.04 % |
| % of genes near scaffold ends (potentially truncated) | 33.01 % |
| % of genes from short scaffolds (< 2000 bps) | 73.79 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (95.146 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (44.660 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.515 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.427 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 20.83% Coil/Unstructured: 37.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13508 | Acetyltransf_7 | 3.88 |
| PF13673 | Acetyltransf_10 | 1.94 |
| PF05362 | Lon_C | 1.94 |
| PF00248 | Aldo_ket_red | 0.97 |
| PF08241 | Methyltransf_11 | 0.97 |
| PF07282 | OrfB_Zn_ribbon | 0.97 |
| PF00004 | AAA | 0.97 |
| PF01037 | AsnC_trans_reg | 0.97 |
| PF00296 | Bac_luciferase | 0.97 |
| PF00988 | CPSase_sm_chain | 0.97 |
| PF00583 | Acetyltransf_1 | 0.97 |
| PF14470 | bPH_3 | 0.97 |
| PF00801 | PKD | 0.97 |
| PF01921 | tRNA-synt_1f | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 1.94 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 1.94 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 1.94 |
| COG1384 | Lysyl-tRNA synthetase, class I | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.15 % |
| Unclassified | root | N/A | 4.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10000030 | All Organisms → cellular organisms → Archaea | 21710 | Open in IMG/M |
| 3300002558|JGI25385J37094_10004744 | All Organisms → cellular organisms → Archaea | 4760 | Open in IMG/M |
| 3300002558|JGI25385J37094_10018909 | All Organisms → cellular organisms → Archaea | 2462 | Open in IMG/M |
| 3300002561|JGI25384J37096_10246217 | Not Available | 521 | Open in IMG/M |
| 3300002562|JGI25382J37095_10094639 | All Organisms → cellular organisms → Archaea | 1069 | Open in IMG/M |
| 3300002562|JGI25382J37095_10180134 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 652 | Open in IMG/M |
| 3300002562|JGI25382J37095_10190822 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 624 | Open in IMG/M |
| 3300002562|JGI25382J37095_10254185 | All Organisms → cellular organisms → Archaea | 530 | Open in IMG/M |
| 3300005167|Ga0066672_10134294 | All Organisms → cellular organisms → Archaea | 1540 | Open in IMG/M |
| 3300005167|Ga0066672_10493769 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 796 | Open in IMG/M |
| 3300005167|Ga0066672_10546733 | All Organisms → cellular organisms → Archaea | 750 | Open in IMG/M |
| 3300005174|Ga0066680_10029039 | All Organisms → cellular organisms → Archaea | 3109 | Open in IMG/M |
| 3300005174|Ga0066680_10149776 | All Organisms → cellular organisms → Archaea | 1459 | Open in IMG/M |
| 3300005174|Ga0066680_10265826 | All Organisms → cellular organisms → Archaea | 1092 | Open in IMG/M |
| 3300005174|Ga0066680_10437531 | All Organisms → cellular organisms → Archaea | 827 | Open in IMG/M |
| 3300005174|Ga0066680_10605233 | All Organisms → cellular organisms → Archaea | 685 | Open in IMG/M |
| 3300005186|Ga0066676_10641037 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 721 | Open in IMG/M |
| 3300005446|Ga0066686_10144735 | All Organisms → cellular organisms → Archaea | 1567 | Open in IMG/M |
| 3300005446|Ga0066686_10762483 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 647 | Open in IMG/M |
| 3300005447|Ga0066689_10001283 | All Organisms → cellular organisms → Archaea | 8694 | Open in IMG/M |
| 3300005518|Ga0070699_100037893 | All Organisms → cellular organisms → Archaea | 4173 | Open in IMG/M |
| 3300005536|Ga0070697_100136682 | All Organisms → cellular organisms → Archaea | 2058 | Open in IMG/M |
| 3300005540|Ga0066697_10083561 | All Organisms → cellular organisms → Archaea | 1845 | Open in IMG/M |
| 3300005552|Ga0066701_10523518 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 732 | Open in IMG/M |
| 3300005554|Ga0066661_10072743 | All Organisms → cellular organisms → Archaea | 2010 | Open in IMG/M |
| 3300005555|Ga0066692_10388448 | All Organisms → cellular organisms → Archaea | 885 | Open in IMG/M |
| 3300005559|Ga0066700_10017329 | All Organisms → cellular organisms → Archaea | 3939 | Open in IMG/M |
| 3300005559|Ga0066700_11014018 | Not Available | 546 | Open in IMG/M |
| 3300005559|Ga0066700_11092967 | All Organisms → cellular organisms → Archaea | 522 | Open in IMG/M |
| 3300005598|Ga0066706_10504608 | All Organisms → cellular organisms → Archaea | 963 | Open in IMG/M |
| 3300006173|Ga0070716_101848482 | Not Available | 501 | Open in IMG/M |
| 3300006755|Ga0079222_10883172 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 747 | Open in IMG/M |
| 3300006797|Ga0066659_10176642 | All Organisms → cellular organisms → Archaea | 1543 | Open in IMG/M |
| 3300007255|Ga0099791_10128928 | All Organisms → cellular organisms → Archaea | 1174 | Open in IMG/M |
| 3300007255|Ga0099791_10183577 | All Organisms → cellular organisms → Archaea | 983 | Open in IMG/M |
| 3300007258|Ga0099793_10642113 | Not Available | 534 | Open in IMG/M |
| 3300007265|Ga0099794_10028566 | All Organisms → cellular organisms → Archaea | 2595 | Open in IMG/M |
| 3300007265|Ga0099794_10144059 | All Organisms → cellular organisms → Archaea | 1208 | Open in IMG/M |
| 3300007265|Ga0099794_10374454 | All Organisms → cellular organisms → Archaea | 742 | Open in IMG/M |
| 3300009038|Ga0099829_10182321 | All Organisms → cellular organisms → Archaea | 1691 | Open in IMG/M |
| 3300009038|Ga0099829_10249248 | All Organisms → cellular organisms → Archaea | 1448 | Open in IMG/M |
| 3300009088|Ga0099830_10577695 | All Organisms → cellular organisms → Archaea | 921 | Open in IMG/M |
| 3300009088|Ga0099830_10687500 | All Organisms → cellular organisms → Archaea | 842 | Open in IMG/M |
| 3300009089|Ga0099828_10396250 | All Organisms → cellular organisms → Archaea | 1245 | Open in IMG/M |
| 3300009089|Ga0099828_11036242 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 730 | Open in IMG/M |
| 3300009089|Ga0099828_11722412 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 551 | Open in IMG/M |
| 3300009137|Ga0066709_101357960 | All Organisms → cellular organisms → Archaea | 1037 | Open in IMG/M |
| 3300010304|Ga0134088_10576468 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 558 | Open in IMG/M |
| 3300012203|Ga0137399_10034541 | All Organisms → cellular organisms → Archaea | 3525 | Open in IMG/M |
| 3300012205|Ga0137362_11536437 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 552 | Open in IMG/M |
| 3300012206|Ga0137380_10048847 | All Organisms → cellular organisms → Archaea | 3878 | Open in IMG/M |
| 3300012206|Ga0137380_10095254 | All Organisms → cellular organisms → Archaea | 2720 | Open in IMG/M |
| 3300012206|Ga0137380_10396408 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1226 | Open in IMG/M |
| 3300012206|Ga0137380_10663336 | All Organisms → cellular organisms → Archaea | 908 | Open in IMG/M |
| 3300012206|Ga0137380_11195632 | Not Available | 645 | Open in IMG/M |
| 3300012349|Ga0137387_10152029 | All Organisms → cellular organisms → Archaea | 1648 | Open in IMG/M |
| 3300012349|Ga0137387_10951060 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 619 | Open in IMG/M |
| 3300012350|Ga0137372_10067598 | All Organisms → cellular organisms → Archaea | 3090 | Open in IMG/M |
| 3300012351|Ga0137386_10057595 | All Organisms → cellular organisms → Archaea | 2694 | Open in IMG/M |
| 3300012359|Ga0137385_10144911 | All Organisms → cellular organisms → Archaea | 2091 | Open in IMG/M |
| 3300012359|Ga0137385_10145966 | All Organisms → cellular organisms → Archaea | 2082 | Open in IMG/M |
| 3300012359|Ga0137385_10146825 | All Organisms → cellular organisms → Archaea | 2075 | Open in IMG/M |
| 3300012359|Ga0137385_10825142 | All Organisms → cellular organisms → Archaea | 769 | Open in IMG/M |
| 3300012361|Ga0137360_10458986 | All Organisms → cellular organisms → Archaea → TACK group | 1080 | Open in IMG/M |
| 3300012917|Ga0137395_10301022 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_2_20CM_2_52_21 | 1136 | Open in IMG/M |
| 3300012918|Ga0137396_10046609 | All Organisms → cellular organisms → Archaea | 2956 | Open in IMG/M |
| 3300012918|Ga0137396_10082104 | All Organisms → cellular organisms → Archaea | 2272 | Open in IMG/M |
| 3300012918|Ga0137396_10232360 | All Organisms → cellular organisms → Archaea | 1359 | Open in IMG/M |
| 3300012918|Ga0137396_10308597 | All Organisms → cellular organisms → Archaea | 1170 | Open in IMG/M |
| 3300012918|Ga0137396_10341508 | All Organisms → cellular organisms → Archaea | 1108 | Open in IMG/M |
| 3300012918|Ga0137396_10604404 | All Organisms → cellular organisms → Archaea | 811 | Open in IMG/M |
| 3300017659|Ga0134083_10239576 | All Organisms → cellular organisms → Archaea | 757 | Open in IMG/M |
| 3300018431|Ga0066655_10299970 | All Organisms → cellular organisms → Archaea | 1046 | Open in IMG/M |
| 3300018431|Ga0066655_10761295 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 657 | Open in IMG/M |
| 3300018431|Ga0066655_10932216 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 596 | Open in IMG/M |
| 3300018468|Ga0066662_10063542 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2430 | Open in IMG/M |
| 3300021046|Ga0215015_11107582 | All Organisms → cellular organisms → Archaea | 1685 | Open in IMG/M |
| 3300021088|Ga0210404_10040951 | All Organisms → cellular organisms → Archaea → TACK group | 2132 | Open in IMG/M |
| 3300024330|Ga0137417_1366537 | All Organisms → cellular organisms → Archaea | 1209 | Open in IMG/M |
| 3300026295|Ga0209234_1144970 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 848 | Open in IMG/M |
| 3300026298|Ga0209236_1082896 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1483 | Open in IMG/M |
| 3300026298|Ga0209236_1111506 | All Organisms → cellular organisms → Archaea | 1218 | Open in IMG/M |
| 3300026309|Ga0209055_1056644 | All Organisms → cellular organisms → Archaea | 1672 | Open in IMG/M |
| 3300026309|Ga0209055_1067850 | All Organisms → cellular organisms → Archaea | 1495 | Open in IMG/M |
| 3300026317|Ga0209154_1006029 | All Organisms → cellular organisms → Archaea | 6215 | Open in IMG/M |
| 3300026317|Ga0209154_1034477 | All Organisms → cellular organisms → Archaea | 2311 | Open in IMG/M |
| 3300026317|Ga0209154_1071288 | All Organisms → cellular organisms → Archaea | 1510 | Open in IMG/M |
| 3300026325|Ga0209152_10000342 | All Organisms → cellular organisms → Archaea | 22647 | Open in IMG/M |
| 3300026328|Ga0209802_1004948 | All Organisms → cellular organisms → Archaea | 8643 | Open in IMG/M |
| 3300026524|Ga0209690_1069031 | All Organisms → cellular organisms → Archaea | 1516 | Open in IMG/M |
| 3300026529|Ga0209806_1002006 | All Organisms → cellular organisms → Archaea | 12893 | Open in IMG/M |
| 3300026538|Ga0209056_10162818 | All Organisms → cellular organisms → Archaea | 1687 | Open in IMG/M |
| 3300026547|Ga0209156_10487289 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 509 | Open in IMG/M |
| 3300027671|Ga0209588_1056749 | All Organisms → cellular organisms → Archaea | 1266 | Open in IMG/M |
| 3300027748|Ga0209689_1136564 | All Organisms → cellular organisms → Archaea | 1209 | Open in IMG/M |
| 3300027846|Ga0209180_10332268 | All Organisms → cellular organisms → Archaea | 868 | Open in IMG/M |
| 3300027846|Ga0209180_10389322 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 791 | Open in IMG/M |
| 3300027862|Ga0209701_10500146 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 660 | Open in IMG/M |
| 3300027875|Ga0209283_10206359 | All Organisms → cellular organisms → Archaea | 1305 | Open in IMG/M |
| 3300027875|Ga0209283_10673982 | All Organisms → cellular organisms → Archaea | 648 | Open in IMG/M |
| 3300027882|Ga0209590_10689598 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 654 | Open in IMG/M |
| 3300028536|Ga0137415_10309569 | All Organisms → cellular organisms → Archaea | 1383 | Open in IMG/M |
| 3300028536|Ga0137415_10775759 | All Organisms → cellular organisms → Archaea | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 44.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 32.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_1000003014 | 3300002558 | Grasslands Soil | MPDQTNAWKIRVRKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| JGI25385J37094_100047442 | 3300002558 | Grasslands Soil | MPDQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| JGI25385J37094_100189092 | 3300002558 | Grasslands Soil | MPDQTNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| JGI25384J37096_102462171 | 3300002561 | Grasslands Soil | MPEQPNTWRIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| JGI25382J37095_100946391 | 3300002562 | Grasslands Soil | MPDQMNTWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| JGI25382J37095_101801342 | 3300002562 | Grasslands Soil | MPEQMNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| JGI25382J37095_101908221 | 3300002562 | Grasslands Soil | MPDQVNAWKIRVKKGNSEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| JGI25382J37095_102541851 | 3300002562 | Grasslands Soil | CAMPDQMNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066672_101342944 | 3300005167 | Soil | MPDQMNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKL |
| Ga0066672_104937692 | 3300005167 | Soil | MPEQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0066672_105467331 | 3300005167 | Soil | NVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| Ga0066680_100290395 | 3300005174 | Soil | MNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| Ga0066680_101497762 | 3300005174 | Soil | MPDQTNSWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066680_102658263 | 3300005174 | Soil | QMNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066680_104375311 | 3300005174 | Soil | MPDQMNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066680_106052331 | 3300005174 | Soil | MPEQTNAWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| Ga0066676_106410372 | 3300005186 | Soil | MPDQTIPWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0066686_101447352 | 3300005446 | Soil | MPEQTNVWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0066686_107624831 | 3300005446 | Soil | AMRDQTNSWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066689_100012832 | 3300005447 | Soil | MNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0070699_1000378936 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDQMSTWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0070697_1001366821 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSMPDQMNTWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066697_100835613 | 3300005540 | Soil | RVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066701_105235181 | 3300005552 | Soil | MPDQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEE |
| Ga0066661_100727433 | 3300005554 | Soil | MPDQMNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| Ga0066692_103884482 | 3300005555 | Soil | AWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0066700_100173291 | 3300005559 | Soil | MPDQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEEL |
| Ga0066700_110140182 | 3300005559 | Soil | MPDQMNVWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0066700_110929672 | 3300005559 | Soil | MPDQMNAWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0066706_105046084 | 3300005598 | Soil | MPEQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLA |
| Ga0070716_1018484822 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDQTNAWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0079222_108831721 | 3300006755 | Agricultural Soil | MPDQMNTWKIRVRKGNYEVEVAGPSPETVQKIFEELVKKYMTKLASSR* |
| Ga0066659_101766421 | 3300006797 | Soil | MPDQTNTWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0099791_101289281 | 3300007255 | Vadose Zone Soil | MPEQTNSWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0099791_101835774 | 3300007255 | Vadose Zone Soil | MPEQTNVWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTELASSR* |
| Ga0099793_106421132 | 3300007258 | Vadose Zone Soil | MPDQANAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0099794_100285662 | 3300007265 | Vadose Zone Soil | MPEQMNVWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0099794_101440592 | 3300007265 | Vadose Zone Soil | MPEQTIPWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0099794_103744542 | 3300007265 | Vadose Zone Soil | MNVWKIRVKKGNSEVEVAGPSPEVVQKMFEELVKKYMTKLASSR* |
| Ga0099829_101823213 | 3300009038 | Vadose Zone Soil | MNVWKIRVKKGNSEVEVAGPSPEVVQKMFEDLVKKYMTKLASSR* |
| Ga0099829_102492482 | 3300009038 | Vadose Zone Soil | MNTWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0099830_105776951 | 3300009088 | Vadose Zone Soil | MPDQNTAWKIRVKKWNSEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| Ga0099830_106875001 | 3300009088 | Vadose Zone Soil | KGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0099828_103962501 | 3300009089 | Vadose Zone Soil | MPDQVNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTRLASSR* |
| Ga0099828_110362422 | 3300009089 | Vadose Zone Soil | MPEQTNVWKIRVKKGNSEVEVAGPSPEIVQKMFEELVKKYMTKLASSR* |
| Ga0099828_117224122 | 3300009089 | Vadose Zone Soil | KKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0066709_1013579602 | 3300009137 | Grasslands Soil | MPEQPNTWRIRVKKGNYEVEVAGPSHEIVQKMFDELVKKYMTKLASSR* |
| Ga0134088_105764681 | 3300010304 | Grasslands Soil | MRDQTNSWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137399_100345413 | 3300012203 | Vadose Zone Soil | MPEQTNAWKIRVKKGNSEVEVAGPSPEIVQRMFEDLVKKYMTKLASSR* |
| Ga0137362_115364372 | 3300012205 | Vadose Zone Soil | IRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137380_100488472 | 3300012206 | Vadose Zone Soil | MPDQTNTWKIKVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137380_100952541 | 3300012206 | Vadose Zone Soil | NSATAAMPDQTNSWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137380_103964083 | 3300012206 | Vadose Zone Soil | MPDQTNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASS |
| Ga0137380_106633362 | 3300012206 | Vadose Zone Soil | KIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137380_111956321 | 3300012206 | Vadose Zone Soil | MPDQTNSWKIRVKKGNYEVEVAGPSPEIVQKMFED |
| Ga0137387_101520291 | 3300012349 | Vadose Zone Soil | WKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137387_109510602 | 3300012349 | Vadose Zone Soil | AMPDQTNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137372_100675981 | 3300012350 | Vadose Zone Soil | WKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0137386_100575952 | 3300012351 | Vadose Zone Soil | MPDESNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137385_101449111 | 3300012359 | Vadose Zone Soil | MPDQTNTWKIRVKKGNSEVEVAGPSPEIVQKMFEALVKNYITKLASSR* |
| Ga0137385_101459662 | 3300012359 | Vadose Zone Soil | MPDQTNSWKIRVKKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137385_101468251 | 3300012359 | Vadose Zone Soil | MPEQTNTWKIKVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137385_108251421 | 3300012359 | Vadose Zone Soil | TWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137360_104589862 | 3300012361 | Vadose Zone Soil | MPDQTNPWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137395_103010223 | 3300012917 | Vadose Zone Soil | MPEQTNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137396_100466092 | 3300012918 | Vadose Zone Soil | MPEQTNVWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR* |
| Ga0137396_100821042 | 3300012918 | Vadose Zone Soil | MPEQMNIWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0137396_102323603 | 3300012918 | Vadose Zone Soil | MPEQTNAWKIRVKKGNSEVEVAGPSPEIVQRMFEELVKKYMTKLASSR* |
| Ga0137396_103085972 | 3300012918 | Vadose Zone Soil | NVWKIRGKKGNSEVEVAGPSPQIVQKMFENLVKK* |
| Ga0137396_103415082 | 3300012918 | Vadose Zone Soil | MNVWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0137396_106044042 | 3300012918 | Vadose Zone Soil | CAMPEQTNVWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR* |
| Ga0134083_102395762 | 3300017659 | Grasslands Soil | ELCNCAMPDQTIAWKITVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0066655_102999702 | 3300018431 | Grasslands Soil | MPEQTNVWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0066655_107612952 | 3300018431 | Grasslands Soil | MPEQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0066655_109322162 | 3300018431 | Grasslands Soil | MPDQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0066662_100635422 | 3300018468 | Grasslands Soil | MPDQMNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0215015_111075822 | 3300021046 | Soil | MPDQTNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0210404_100409511 | 3300021088 | Soil | MPDQTNAWKIRVRKGNYEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0137417_13665371 | 3300024330 | Vadose Zone Soil | MPEQTNVWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209234_11449701 | 3300026295 | Grasslands Soil | MPEQPNTWRIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209236_10828964 | 3300026298 | Grasslands Soil | MNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209236_11115064 | 3300026298 | Grasslands Soil | MPDQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEDLVKKYMTKLASSR |
| Ga0209055_10566443 | 3300026309 | Soil | MPDQTIPWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209055_10678501 | 3300026309 | Soil | MNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR |
| Ga0209154_10060296 | 3300026317 | Soil | MNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMT |
| Ga0209154_10344771 | 3300026317 | Soil | MPDQMNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR |
| Ga0209154_10712884 | 3300026317 | Soil | MPDQMNVWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMT |
| Ga0209152_1000034222 | 3300026325 | Soil | MPDQMNVWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209802_10049488 | 3300026328 | Soil | MPEQMNAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209690_10690314 | 3300026524 | Soil | MPDQVNAWKIRVKKGNSEVEVAGPSPEIVQKMFEELVKKYMTKLASSR |
| Ga0209806_10020066 | 3300026529 | Soil | MPDQTNTWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209056_101628184 | 3300026538 | Soil | MPDQTIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLA |
| Ga0209156_104872892 | 3300026547 | Soil | VKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209588_10567492 | 3300027671 | Vadose Zone Soil | MPEQTIPWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209689_11365642 | 3300027748 | Soil | MPDQTNSWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209180_103322682 | 3300027846 | Vadose Zone Soil | SRAMPDQPIAWKIRVKKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209180_103893222 | 3300027846 | Vadose Zone Soil | MPDQPIAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209701_105001461 | 3300027862 | Vadose Zone Soil | GSANGAMPDQTNSWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| Ga0209283_102063592 | 3300027875 | Vadose Zone Soil | MNVWKIRVKKGNSEVEVAGPSPEVVQKMFEDLVKKYMTKLASSR |
| Ga0209283_106739821 | 3300027875 | Vadose Zone Soil | KKGNYEVEVAGPSHEIVQKMFEELVKKYMTKLASSR |
| Ga0209590_106895982 | 3300027882 | Vadose Zone Soil | KIRVKKGNSEVEVAGPSPEIVQKMFEELVKKYMTKLASSR |
| Ga0137415_103095691 | 3300028536 | Vadose Zone Soil | MPEQTNAWKIRVKKGNYEVEVAGPSPEIVQKMFEELVKKYMTKLASSR |
| Ga0137415_107757591 | 3300028536 | Vadose Zone Soil | MPDQANAWKIRVKKGNSEVEVAGPSPEIVQKMFEDLVKKYMTKLASSR |
| ⦗Top⦘ |