 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F099684 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ALSLFLSKKGIKEHVRVGAKKVLISPSFYKERMKEAKKLVYELRKPN |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.029 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.359 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.806 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.427 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.00% β-sheet: 13.33% Coil/Unstructured: 50.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00882 | Zn_dep_PLPC | 57.28 |
| PF04366 | Ysc84 | 3.88 |
| PF00092 | VWA | 1.94 |
| PF11752 | DUF3309 | 1.94 |
| PF13545 | HTH_Crp_2 | 0.97 |
| PF04041 | Glyco_hydro_130 | 0.97 |
| PF07311 | Dodecin | 0.97 |
| PF13426 | PAS_9 | 0.97 |
| PF13519 | VWA_2 | 0.97 |
| PF13560 | HTH_31 | 0.97 |
| PF00990 | GGDEF | 0.97 |
| PF13237 | Fer4_10 | 0.97 |
| PF13610 | DDE_Tnp_IS240 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 3.88 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.97 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.03 % |
| All Organisms | root | All Organisms | 0.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300012202|Ga0137363_10001563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13267 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 17.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.97% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004138 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF246 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_101289322 | 3300000550 | Soil | SLFLSKKGIDEHVRVGDSKILISPTFYKERMKEAKRIVAELKTSN* |
| JGI1027J12803_1057489091 | 3300000955 | Soil | SCRRKGIEEHVRAGDNKVLISPTFYKERMKEAKKIVTQLRKSD* |
| JGI12635J15846_100579241 | 3300001593 | Forest Soil | GIKEHVRVGEKRVLISPSFYKERMKEAKRVVHELRKPN* |
| JGI12053J15887_104509863 | 3300001661 | Forest Soil | LFLSKKGIKERVRVGGKDILISPTFYKERMKEAKKLVDELRKSK* |
| Ga0062389_1021910391 | 3300004092 | Bog Forest Soil | YKALALFLAKKGIEEHVRVGSRKVLISPTFYKERMNEAKKLVNEIRKSNWT* |
| Ga0058905_15299072 | 3300004138 | Forest Soil | SLFLSKKGVKEHLRVGEKKVRISPSFYKERMKEAKKLVYELRKPN* |
| Ga0062386_1001279845 | 3300004152 | Bog Forest Soil | LSKKDFKQHMPLGGKETLLRPTFYKERMKEAKKLVTELRKSS* |
| Ga0062386_1007897222 | 3300004152 | Bog Forest Soil | ALSLFLSKKGIKEHLRVGQKKVLIGPTFYRERIKEAKKLVSELRKPV* |
| Ga0058899_117505161 | 3300004631 | Forest Soil | SLFLSKKGIKADVRLGQKKVLVSSAYYKERMREAKKLVHELKKTN* |
| Ga0058899_122023632 | 3300004631 | Forest Soil | SKKGIKEPVRVGVRKIVISPTFYKDRVKEAEKLVYELRKPS* |
| Ga0070711_1018147382 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YMALSLFLSKKGIKGHVRVGERKVLISPTFYKDRMKEAKKLVYELRKPN* |
| Ga0070698_1018353212 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKKGIKEHVRVGERKVLISPSFYKERMKEAKKLVYELRKPN* |
| Ga0070699_1018722951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SLFLSKKGIKEHVRVGERKVLISPSFYKERMKEAKKLVYELRKQD* |
| Ga0070732_108833351 | 3300005542 | Surface Soil | LFLSKKGIKEHVRVGQKEFFIRPSFYKERVKEAKRLVHELRKPN* |
| Ga0070763_101681472 | 3300005610 | Soil | TYLALSLFLSKKGIKADVFLGEKKVVISPSYYKERMKEAKKLVHELRKSN* |
| Ga0075028_1006144541 | 3300006050 | Watersheds | ALSLFLSKKGIKEHVRVGAKKVLISPSFYKERMKEAKKLVYELRKPN* |
| Ga0075019_100553071 | 3300006086 | Watersheds | EHVRVGEKSVLISPSFYKERVKEAKKLAYELRKSG* |
| Ga0075014_1006883422 | 3300006174 | Watersheds | ARKGTKQHVHVGATVVLISPLFYKERMKEAKKLVNELRNAN* |
| Ga0070765_1009407222 | 3300006176 | Soil | SLFLSKKGIKVHVRVGEKRVLVSPSFYKERMKEAKRVVHELRKPS* |
| Ga0079221_102903261 | 3300006804 | Agricultural Soil | LSKKGIKETLQVGEKEALISPTFYKERIKEAKKLINELRTPN* |
| Ga0079219_113749411 | 3300006954 | Agricultural Soil | TYMALSLFLSKKGVKEHVRVGERKVLISPSFYEDRRKEARKLVNELRKPN* |
| Ga0099829_100335141 | 3300009038 | Vadose Zone Soil | SLFLSKKGIKADMRVGAKKVIISPSFYKERMKEAKKLVYELRKPN* |
| Ga0075423_126571451 | 3300009162 | Populus Rhizosphere | MALSLFLSKRGIDEQVRVGGRKIMISPTFYKERMKEAKKIVAELRKSD* |
| Ga0105249_104978791 | 3300009553 | Switchgrass Rhizosphere | ALSLFFSKKGIKEHVRFGEKKVLISPTFYEGRIKEATKIIQDLGNTN* |
| Ga0116223_105155672 | 3300009839 | Peatlands Soil | HVRVGASTVLMCPLFYKERMKEAKKLVCELKRSN* |
| Ga0074045_109561711 | 3300010341 | Bog Forest Soil | KTDMALSLFFSKKGVKEHLRVGQKKVLLSPTFYKERIKEARRLVFELRKPD* |
| Ga0150983_128742241 | 3300011120 | Forest Soil | ADVFLGEKKVVISPSYYKERMKEAKKLVHELRKSN* |
| Ga0150983_145971692 | 3300011120 | Forest Soil | MALSLFLSKKGIKEHVRAGQENLVGPSFYKERMREAKKLVHELRNPS* |
| Ga0150983_151159192 | 3300011120 | Forest Soil | ALALFLSKRGIKEHVRVGAKKVLISPTFYKDRMKEAKKLLNDLRKPN* |
| Ga0150983_161993561 | 3300011120 | Forest Soil | KEHVRVGEKRILLSPSFYKERVKEAKKLVYDLRKPN* |
| Ga0150983_162204701 | 3300011120 | Forest Soil | LAKNDIKEHVRVGGNKVMFHPAFYKDRMKEAKKLVYELKKAN* |
| Ga0137392_105517711 | 3300011269 | Vadose Zone Soil | HVRIGEKRVLISPSFYKERMLEAKKLVYELKKSD* |
| Ga0137388_111595022 | 3300012189 | Vadose Zone Soil | YAALSLFLTKKGIKTDVRVGVKKVFKSPLFYKERMKEAKKIVYELRKPN* |
| Ga0137363_1000156318 | 3300012202 | Vadose Zone Soil | MALSIFLSKKGIEEHVRVGASKILINPTFYKERMKEAKKIVAQLKRPN* |
| Ga0137361_116344101 | 3300012362 | Vadose Zone Soil | KTYMALSIFLSKKGIEEHVRVGASKILINPTFYKERMKEAKKIVAQLKRPN* |
| Ga0157374_112680651 | 3300013296 | Miscanthus Rhizosphere | KALSLFFSKKGIKEHVRFGEKKVLISPTFYEGRIKEATKIIQDLGNTN* |
| Ga0181518_100557642 | 3300014156 | Bog | MHPAGSLFLSKNGFKKQVRVGEKQVLNSTSFYQEGMKEANKLVFELRKRN* |
| Ga0182018_103763422 | 3300014489 | Palsa | TYAALSLFLSKKGVREHLRAGAKKVLASPSYYKDRMKEAKKLVYDLRTSD* |
| Ga0137420_12323462 | 3300015054 | Vadose Zone Soil | KADVRVGEKKVLISPSYYKERMKEAKRVVYELRKPN* |
| Ga0137403_100450626 | 3300015264 | Vadose Zone Soil | IKTYAALSLFLTNKGIKTDVRVGARKVFKSPLFYKERMKEAKKIVYELRKPN* |
| Ga0187856_11038821 | 3300017925 | Peatland | ERMRVGGKEILISPTFYKERMKEAKKLVDQLRKSN |
| Ga0187822_102207661 | 3300017994 | Freshwater Sediment | LALSLFLSKRGTKTDLRLGKKKLLINPAFYKERMKEAKKLVYELRRTK |
| Ga0187886_11239592 | 3300018018 | Peatland | TYMALSLFLSKKGIKEHLRVGENKVLISPTFYKERIKEARKLVFELRKPD |
| Ga0193733_11732601 | 3300020022 | Soil | SLFLSKKGIKQHVRAGEKKVVISPSFYKERMKEAKKLVYELRNPN |
| Ga0179594_102507971 | 3300020170 | Vadose Zone Soil | AALSLFLTKKGIKTDVRVGARKVFKSPLFYKERMKEAKKIVYELRKPN |
| Ga0210407_102868982 | 3300020579 | Soil | TYLALSLFLSKRGIKADLRLGEKKVLISPAFYKERMKEAKKVVHELTRTK |
| Ga0210403_102074813 | 3300020580 | Soil | LFLTKKGIKEHVRVGEKSVLISPSFYKERVKEAKKLACELRKSG |
| Ga0210399_100889001 | 3300020581 | Soil | LFLSKDGIKEHARMEKKKVLISPTFYKERMKEAKKLVYELRKPN |
| Ga0210399_101601511 | 3300020581 | Soil | KTYTALSLFLSKKGVREHLRAGANKLLISPSFYKERMKEAKKLVYDLRKTD |
| Ga0210401_103785532 | 3300020583 | Soil | GVREHLRAGANKLLISPSFYKERMKEAKKLVYDLRKTD |
| Ga0210401_112399682 | 3300020583 | Soil | EKEIKTYTALSLFLTKKGIKEHVRVGEKSVLISPSFYKEIVKEAKKLACELRKSG |
| Ga0210400_100327055 | 3300021170 | Soil | YLALSLFLSKRGIKADVRVGAKRVLISPSFYKERMKEAKKLVYELKKPN |
| Ga0210400_100843431 | 3300021170 | Soil | EHVHVGEKKVLISPSFYKERMKEAKKIVHELRKPN |
| Ga0210396_102187531 | 3300021180 | Soil | EHVRVGEESVLISPSFYKERVKEAKKLACELRKSG |
| Ga0210388_107669051 | 3300021181 | Soil | TKKGIKEHIRVGEKSVLISPSFYKERMKEARKLASELRKPR |
| Ga0210388_113390651 | 3300021181 | Soil | ALSLFLSKRGIKTDLLLGTKKVLISPSFYKDRMKEAKKLVRELRRT |
| Ga0210389_101518671 | 3300021404 | Soil | YAALSLFLTKKGTKQRVHLGATVVLINPLFYKERMKEAKKLVNELRNAN |
| Ga0210394_116440111 | 3300021420 | Soil | SKRGVTEHVRVGEEKNPVGPSFYKERMNEAKKLVDELRTPNRTPN |
| Ga0210384_114286241 | 3300021432 | Soil | EHVRVGEKRVLISPSFYKDRMKEAKKLVYELRKSN |
| Ga0210398_114259692 | 3300021477 | Soil | KEIKTYLALSLFLSKRGIKSDLRLGAKKVLISPAFYKERMKEAKKLVYELRKTK |
| Ga0210402_109570661 | 3300021478 | Soil | SKRGIKADVRVGAKRVLISPSFYKERMKEAKKLVHELKKPN |
| Ga0210410_101815161 | 3300021479 | Soil | YLALSLFLSKRGIKADLRLGEKKVLISPAFYKERMKEAKKVVHELRKTK |
| Ga0210410_103836552 | 3300021479 | Soil | YLALSLFLSKKGIKADVRVGEKKVLISPSYYKERMKEAKRVVYELRKPN |
| Ga0210409_101261213 | 3300021559 | Soil | MALSLFLSKEGIKEHARMEKKKVLISPSFYKERMKEAKRLVYELKKPN |
| Ga0207692_103360252 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IKTYLALSLFLSKKDIEQHVRVGSRKILIGPTFYKERMQEVKKIVAELKRSN |
| Ga0207685_104407371 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKKNIKEHVRVGAKKVLISPAFYKERVKEAKKLVYELRHPN |
| Ga0207663_102123991 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SLFLSKKGIEEHVRVGDNKILISPTFYKERMKEAKKIVTELRKSN |
| Ga0207648_105154312 | 3300026089 | Miscanthus Rhizosphere | KRGIEEHIRVGDKKILISPTFYKERMKEAKTIVAELRNSD |
| Ga0207676_104322331 | 3300026095 | Switchgrass Rhizosphere | TYMALSLFLSKKGIDEHVRVGDSKILIHPTFYKERMKEAKKIVSELRRSN |
| Ga0208859_10473381 | 3300027069 | Forest Soil | YTALSLFLSKKGGSKHPSAGANSAVIGPSFYKERMKEAKKLVYDLRTAD |
| Ga0209735_10446202 | 3300027562 | Forest Soil | SKKDRDDHVRVGGKKVIISPAFYKDRMKEAKKIVSELKKAN |
| Ga0209331_10416492 | 3300027603 | Forest Soil | KEHVRVGERKVLISPSFYKERVKEAKKLVYELRKQD |
| Ga0208324_11924331 | 3300027604 | Peatlands Soil | KKGIKGRVRVGGKEILISPSFYKERMKEAKKLVDQLRKSN |
| Ga0209117_10418083 | 3300027645 | Forest Soil | YLALSLFLLKKGIKLHVRMGERKGLLSPTFYKERMKEAKKLVLELGGKPA |
| Ga0209178_12172461 | 3300027725 | Agricultural Soil | LSKKGIKETLQVGEKEALISPTFYKERIKEAKKLINELRTPN |
| Ga0209074_103170401 | 3300027787 | Agricultural Soil | LSTKGIKEHVRVREKKVLISPSFYKERIKEAKKLVHELRKPN |
| Ga0209074_104842102 | 3300027787 | Agricultural Soil | KGVKEHVRVGERKVLISPSFYEDRRKEARKLVNELRKPN |
| Ga0209693_100835601 | 3300027855 | Soil | FLSKKGIKADVFLGEKKVVISPSYYKERMKEAKKLVHELRKSN |
| Ga0209693_102053361 | 3300027855 | Soil | TALSLFLSKKGVREQLRAGAKKALTSPSYYKDRMKEAKKLVYDLRTPD |
| Ga0209698_101318494 | 3300027911 | Watersheds | SLFLSKKGIKGHVLVGEKRVLISPTFYKDRMKEAKRLVSELNKSN |
| Ga0247682_10642031 | 3300028146 | Soil | MALSLFLAKKGIDEHVCVGDKKILISPTFYKERMKEAKRIVAELKTSN |
| Ga0222749_101351841 | 3300029636 | Soil | KKGIKEHMRVGEKRVLISPSFYKDRMKEAKKLVYELRKSN |
| Ga0075385_110672072 | 3300030854 | Soil | TYAALSLFLTKKGIKEHVRVGEKSVLISPSFYKERMKEARKLASELRKPRH |
| Ga0170823_104643561 | 3300031128 | Forest Soil | EIKTYLALSLFLSKKGVEEHVCVGDNKILINPTFYKERMKEAKKIVTELRKSNEQVCCAC |
| Ga0307476_100118636 | 3300031715 | Hardwood Forest Soil | GIKEHVRVGERKVLISPTFYKDRMKEAKKLVYELRKPN |
| Ga0307469_107174081 | 3300031720 | Hardwood Forest Soil | SLFLTKKGIKTDVRVGAKKVFKSPSFYIERMKEAKKIVYELRKPN |
| Ga0307477_105497461 | 3300031753 | Hardwood Forest Soil | RKGIKEQVRVGEKKVLISPSFYKERVKEAKKLVYELRKPN |
| Ga0307477_105782312 | 3300031753 | Hardwood Forest Soil | IREHARTEKRKVLISPTFYKERMKEAKKLVYELKNPN |
| Ga0307475_102762451 | 3300031754 | Hardwood Forest Soil | KEIKTYLALSLFLSKKDIDEHVRVGARKILIGPTFYKERMKEAKKIVLELKRSN |
| Ga0307475_109944911 | 3300031754 | Hardwood Forest Soil | KEHVRVGEKKVLISPTFYKERVKEAKKLVCELRKPD |
| Ga0307473_103499041 | 3300031820 | Hardwood Forest Soil | SKKGIKADVRVGARKVLISPSFYKERMKEAKRLVYDLKKTN |
| Ga0307473_109088612 | 3300031820 | Hardwood Forest Soil | GIEEHVRVGEKRVFISPTFYKERMKEAKRLVNELRKYT |
| Ga0307473_115379572 | 3300031820 | Hardwood Forest Soil | KAGVRVGAKKVLISPSFYKERMKEAKKLVYELRKPN |
| Ga0307478_102192101 | 3300031823 | Hardwood Forest Soil | YLALSLFLSKRGIKTDLLLGKKKTLISPAFYKERMKEAKELIYELRSTK |
| Ga0307478_109540812 | 3300031823 | Hardwood Forest Soil | GIKEQVRVGQKEVFTRPSFYKERVKEAKRLVHELRKPN |
| Ga0307479_104769182 | 3300031962 | Hardwood Forest Soil | TYMALSLFLSKKGIKEHVRVGEKRVLISPSFYKERMKEAKRVVYELRKPI |
| Ga0307470_102565521 | 3300032174 | Hardwood Forest Soil | YLALSLFLSKKDIEEHVRVGTRKILIGPTFYKERMKEAKKIVTDLKSSN |
| Ga0307471_1004383252 | 3300032180 | Hardwood Forest Soil | IKADVRVGEKKVLISPKFYKERMREAKKLVHELRKPI |
| Ga0307471_1007981851 | 3300032180 | Hardwood Forest Soil | FLSKKGIQERAQVEQKKTILSPSFYKERMKEAKKLVYELRKPN |
| Ga0307471_1019082881 | 3300032180 | Hardwood Forest Soil | KKGIKADVRVGAKKVIISPSFYKERMKEAKKLVYELRKPN |
| Ga0307472_1014619431 | 3300032205 | Hardwood Forest Soil | LFLSKKDIEEHVRVGARRILIGPTFYKERMKEAKKIVTELKRSN |
| Ga0307472_1014632741 | 3300032205 | Hardwood Forest Soil | SLFLSKNGIKERVRVGEKEVLISPSFYKERMKEAKKLVYELRKPN |
| Ga0335069_126742082 | 3300032893 | Soil | YTALSLFLSKKGIKEHLQVGDKKVLISPMYYKERMKEAKRLIFELRKPD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |