NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099677

Metagenome / Metatranscriptome Family F099677

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099677
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 64 residues
Representative Sequence GSIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLILNNYSGKTRQSLATTGFAARLV
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.81 %
% of genes near scaffold ends (potentially truncated) 76.70 %
% of genes from short scaffolds (< 2000 bps) 85.44 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.291 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(23.301 % of family members)
Environment Ontology (ENVO) Unclassified
(32.039 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.806 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00589Phage_integrase 11.65
PF13517FG-GAP_3 1.94
PF08843AbiEii 0.97
PF13418Kelch_4 0.97
PF13749HATPase_c_4 0.97
PF00271Helicase_C 0.97
PF00532Peripla_BP_1 0.97
PF02806Alpha-amylase_C 0.97
PF13377Peripla_BP_3 0.97
PF09983DUF2220 0.97
PF13469Sulfotransfer_3 0.97
PF12833HTH_18 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.97
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.97
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.97
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.29 %
UnclassifiedrootN/A9.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_13911731All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium857Open in IMG/M
3300000567|JGI12270J11330_10212441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia650Open in IMG/M
3300004024|Ga0055436_10172709All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia668Open in IMG/M
3300005187|Ga0066675_10090428All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300005531|Ga0070738_10004423All Organisms → cellular organisms → Bacteria16894Open in IMG/M
3300005602|Ga0070762_11031261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia565Open in IMG/M
3300005610|Ga0070763_10539532All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia671Open in IMG/M
3300006046|Ga0066652_100241455All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300006174|Ga0075014_100888277All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia533Open in IMG/M
3300006893|Ga0073928_10058275All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3430Open in IMG/M
3300009522|Ga0116218_1262641All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia775Open in IMG/M
3300009623|Ga0116133_1122728Not Available670Open in IMG/M
3300009628|Ga0116125_1031732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1320Open in IMG/M
3300009638|Ga0116113_1081392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia769Open in IMG/M
3300009759|Ga0116101_1113535All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia639Open in IMG/M
3300009870|Ga0131092_11252450All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia581Open in IMG/M
3300010341|Ga0074045_10651225All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia670Open in IMG/M
3300012232|Ga0137435_1228011All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium568Open in IMG/M
3300012929|Ga0137404_11169048All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia707Open in IMG/M
3300012943|Ga0164241_10601208All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium795Open in IMG/M
3300014153|Ga0181527_1030665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3206Open in IMG/M
3300014160|Ga0181517_10323103All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia806Open in IMG/M
3300014167|Ga0181528_10231839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia996Open in IMG/M
3300014304|Ga0075340_1059543All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia688Open in IMG/M
3300014492|Ga0182013_10498034All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia635Open in IMG/M
3300014493|Ga0182016_10005462All Organisms → cellular organisms → Bacteria13681Open in IMG/M
3300014494|Ga0182017_10624558All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia655Open in IMG/M
3300014495|Ga0182015_10803060All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia591Open in IMG/M
3300014655|Ga0181516_10031444All Organisms → cellular organisms → Bacteria2719Open in IMG/M
3300014657|Ga0181522_10765557All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia591Open in IMG/M
3300014839|Ga0182027_10024205All Organisms → cellular organisms → Bacteria8028Open in IMG/M
3300016728|Ga0181500_1535340Not Available590Open in IMG/M
3300016750|Ga0181505_10994506All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia551Open in IMG/M
3300017925|Ga0187856_1060772All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300017959|Ga0187779_10942815All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium596Open in IMG/M
3300017988|Ga0181520_11018636All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia547Open in IMG/M
3300018008|Ga0187888_1104026All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1206Open in IMG/M
3300018042|Ga0187871_10118791All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1511Open in IMG/M
3300018081|Ga0184625_10660739Not Available505Open in IMG/M
3300018088|Ga0187771_11879721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia508Open in IMG/M
3300019256|Ga0181508_1465746Not Available509Open in IMG/M
3300019258|Ga0181504_1265468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii540Open in IMG/M
3300019270|Ga0181512_1032533Not Available548Open in IMG/M
3300020581|Ga0210399_10279659All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300021433|Ga0210391_10665074All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia817Open in IMG/M
3300021474|Ga0210390_10927845All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia715Open in IMG/M
3300023250|Ga0224544_1067054All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia522Open in IMG/M
3300024288|Ga0179589_10295095All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia728Open in IMG/M
3300026320|Ga0209131_1158114Not Available1134Open in IMG/M
3300026547|Ga0209156_10423696All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300027965|Ga0209062_1005765All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia11801Open in IMG/M
3300028552|Ga0302149_1032302All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1366Open in IMG/M
3300028552|Ga0302149_1073535All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia880Open in IMG/M
3300028560|Ga0302144_10094725All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia960Open in IMG/M
3300028748|Ga0302156_10473206All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia537Open in IMG/M
3300028800|Ga0265338_10051179All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales3722Open in IMG/M
3300028800|Ga0265338_10988375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium570Open in IMG/M
3300028873|Ga0302197_10413613All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia595Open in IMG/M
3300028874|Ga0302155_10301688All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia689Open in IMG/M
3300029798|Ga0239581_1059821All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium836Open in IMG/M
3300029883|Ga0311327_10029568All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4536Open in IMG/M
3300029883|Ga0311327_10916209All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia505Open in IMG/M
3300029907|Ga0311329_10920527All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia548Open in IMG/M
3300029911|Ga0311361_11139409All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia632Open in IMG/M
3300029914|Ga0311359_10015750All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales9587Open in IMG/M
3300029915|Ga0311358_10593519All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia838Open in IMG/M
3300029922|Ga0311363_10878435All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia809Open in IMG/M
3300029922|Ga0311363_11390417All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium573Open in IMG/M
3300029952|Ga0311346_10233032All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300029953|Ga0311343_10764151All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia795Open in IMG/M
3300029953|Ga0311343_11081503All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia622Open in IMG/M
3300029954|Ga0311331_11290108All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia609Open in IMG/M
3300029955|Ga0311342_10882682All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia677Open in IMG/M
3300029986|Ga0302188_10464487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia515Open in IMG/M
3300030020|Ga0311344_10421160All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1217Open in IMG/M
3300030057|Ga0302176_10238888All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia727Open in IMG/M
3300030507|Ga0302192_10019859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3850Open in IMG/M
3300030520|Ga0311372_11328734All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia905Open in IMG/M
3300030688|Ga0311345_10384462All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300030737|Ga0302310_10493938All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia658Open in IMG/M
3300030848|Ga0075388_11266374All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia678Open in IMG/M
3300031122|Ga0170822_10082863All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia543Open in IMG/M
3300031234|Ga0302325_10446688All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1985Open in IMG/M
3300031236|Ga0302324_102808576All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium585Open in IMG/M
3300031524|Ga0302320_10314860All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2062Open in IMG/M
3300031524|Ga0302320_11197080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia779Open in IMG/M
3300031525|Ga0302326_10776185All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1385Open in IMG/M
3300031525|Ga0302326_13566424All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium515Open in IMG/M
3300031595|Ga0265313_10150531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia995Open in IMG/M
3300031708|Ga0310686_114365438All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1148Open in IMG/M
3300031708|Ga0310686_114513617Not Available642Open in IMG/M
3300031788|Ga0302319_10025764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii10395Open in IMG/M
3300032156|Ga0315295_10435742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1333Open in IMG/M
3300032164|Ga0315283_10280442All Organisms → cellular organisms → Bacteria1805Open in IMG/M
3300032275|Ga0315270_10489209All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300033818|Ga0334804_116766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia681Open in IMG/M
3300033819|Ga0334816_032191All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1010Open in IMG/M
3300033828|Ga0334850_077874All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300033829|Ga0334854_064281Not Available875Open in IMG/M
3300033977|Ga0314861_0504064All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium519Open in IMG/M
3300034065|Ga0334827_100970All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium952Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog23.30%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.80%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.83%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.94%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.94%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.97%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.97%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.97%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.97%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.97%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.97%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029798Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033819Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-MEnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1391173113300000363SoilKAAFAGSIPTLASNSKLLFGNMLQKPEEASASESASEIKTGPLRIENPGSTRQPLEMTGFAACLV*
JGI12270J11330_1021244123300000567Peatlands SoilPIPTLASNPKLHFCNGLQMPEEVSASESASEINTGLPLNNYSGKTRQSLATTGYAARLV*
Ga0055436_1017270913300004024Natural And Restored WetlandsGSAKAAFVGSIPTLASNSKLHFCNELQIPEEASASESASEINTGLRLNNYSGITRQSLAMTGFAARLV*
Ga0066675_1009042833300005187SoilMNASRFGAIPTLASNFKLHFCNELQQPEGASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV*
Ga0070738_1000442393300005531Surface SoilMGPIPTLASNSKLHFCNGLQKPEEASASESASEINTGIRLNNYSGITRQSLAMTGFAACLV*
Ga0070762_1103126123300005602SoilKHNINVIRHQRRSIPTLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV*
Ga0070763_1053953223300005610SoilGRRGKGPIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV*
Ga0074470_1133766223300005836Sediment (Intertidal)MKSGIFEVQRRGIWPIPTLASNSKLHFCNGLQIPEEASASESASEINTGQRLNNYSGITRQSLAMTGFAARLV*
Ga0066652_10024145523300006046SoilMDEQEIRSPIPTLASNSKLHFCNGLQIPEEASASESASEINTGIRLNNYSGITRQSLATTGFAARLV*
Ga0075014_10088827713300006174WatershedsRHGSAKAAFVGSIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV*
Ga0073928_1005827513300006893Iron-Sulfur Acid SpringGSAKALCVGSIPTLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRQSLATKGFAARLV*
Ga0116218_126264113300009522Peatlands SoilPTLASNSKLRFFNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV*
Ga0116133_112272823300009623PeatlandLITEGKRVHLSRKRGEKGPIPTLASNSKLRICNELQNPEEASASESASEIITGLKLSNYSGITRPSLATKGFAA
Ga0116125_103173213300009628PeatlandLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLAKTGFAARLVCLTHQKPRATS*
Ga0116113_108139213300009638PeatlandKASSVGSIPTPASNSKLLFCNGLQMPEEASASESASEINTGLGLNNYSGKTRQSLATTGFAARLV*
Ga0116101_101883223300009759PeatlandMKKFAQIVRKLLILLGKSSIFLLRKRNMNRPIPTLASNSKLHFCNGLQMPEEASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV*
Ga0116101_111353523300009759PeatlandQVKLLIRNNLCHFFNNSSPTLASNSKLHFCNGLQMPEEFSASESASEDNTRHFNNCSGKTRQSLATTGFAARLV*
Ga0131092_1125245013300009870Activated SludgeIPTLASNFKLRNCSELQPPEEASASESASEINTGIRLNNYSGNTRQSLAMTGFAARLV*
Ga0074045_1065122523300010341Bog Forest SoilVEGGKRPIPTLASNSKLLFGNELQKPEESSASESASEINTGILLNNCSGITWQSLATTGFAARLV*
Ga0137435_122801113300012232SoilKAAFVGSIPTLASNSKLHFCNGLQIPEGASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV*
Ga0137404_1116904813300012929Vadose Zone SoilKHGEKWPIPTLASNSKLSFCNELQIPEEASASERNTGIRLNNYSGITRQSLAMTGFAACLV*
Ga0164241_1060120813300012943SoilMGFEKNRYFCSIPTLASNSKLHFCNELQQPEGASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV*
Ga0181527_103066523300014153BogMKSGILRTQRREIRPIPTLASNSKLHFCNGLQMPEEASASESASENNTGLLLNNYSGKTRQSLATTGFAARLV*
Ga0181517_1032310323300014160BogDETRSIPTLASNSKLHFCNGLQMPEEVSASESASEIITGRLLNNYSGKTRQSLATTGFAARLV*
Ga0181528_1023183943300014167BogSIPTLASNSKLHFCNELQMPEEVSASEINTGQLLNKYSGKTRQSLVTTGFAARLVCLTHR
Ga0075340_105954323300014304Natural And Restored WetlandsSIPTLASNFKLLKNSKLQIPEEASASESASEINTGIKLYHYPAINWQSLAMAGFAARMV*
Ga0182013_1049803413300014492BogTSASNSKLHFCNGLQMPEEASASESASEIITGLLLNNYSGKTRQSLATMGFAARLV*
Ga0182016_10005462143300014493BogVEGGMRPIPTPASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRQSLATKGFAARLV*
Ga0182017_1062455813300014494FenIPTLASNSKLRNSSELQIPEEASASESASEIITGIRLNNYSGITRQSLAMTGFAARLV*
Ga0182015_1080306023300014495PalsaARCHCPIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV*
Ga0181516_1003144433300014655BogVEDETRSIPTLASNSKLRFGNELQMPEEACASESASEINTGIRLNNYSGITRQSLAMTGFAARLV*
Ga0181522_1076555723300014657BogTLASNSKLHFCNGLQMPEEVSASESASENNTGLLLNNYSGRTWQSLATTGFAARLV*
Ga0182027_1002420573300014839FenMVDFEWLVEGGTRPIPTLASNSKLLFCNELQLPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV
Ga0181500_153534023300016728PeatlandPIPTLASNSKLHFCNELQMPEEVSASEINTGQLLNKYSGKTRQSLATTGFAARLVG
Ga0181505_1099450623300016750PeatlandPIPTPASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRQSLATTGFAARLV
Ga0187856_106077223300017925PeatlandMGSIPTLASNSKVLFGKKLQLPEEAGASESASEIITGLELSNYSGITRPSLATTGFAARL
Ga0187779_1094281523300017959Tropical PeatlandMRSIPTLASNFKLRNCSELQIPEGASASESASEIITGIRLNNYSGITRQSLAITGFAARL
Ga0181520_1101863623300017988BogIPTLASNSKLLFCNELQHPEEASASESASEINTGLILNNYSGKTRQSLATTGFAARLVCLTHQ
Ga0187888_110402623300018008PeatlandGSIPTLASNSKVLFGKKLQLPEEAGASESASEIITGLELSNYSGITRPSLATTGFAARLV
Ga0187871_1011879113300018042PeatlandMNRPIPTLASNSKLLFCNELQMPEEVSASESASEINTPAVLNNYSGKTRQSLATTGFAARLV
Ga0184625_1066073913300018081Groundwater SedimentNRTPKRTQKGFSNHDRKWSIPTSASNFKLHFCNELQQPEGASASESASEIITPAVLNNYSGKTRQSLATTGFAARLV
Ga0187771_1187972113300018088Tropical PeatlandNSKLRFCNELQKSEEASASESASEIITGRLLNNDSGKTRPSLATTGFAAHLVCLTRQKPRSTS
Ga0181508_146574623300019256PeatlandGTVKSPRSIPTLASNSKLHFCNELQMPEEVSASEINTGQLLNKYSGKTRQSLATTGFAARLVG
Ga0181504_126546823300019258PeatlandVDFEWLVEGGTRPIPTLASNSKLHFCNGLQMPEEVSASESASENNTGLLLNNYSGKTWQSLATTGFAARLV
Ga0181512_103253313300019270PeatlandQQVKTRCACPIPTLASNSKLHFCNELQMPEEVSASEINTGQLLNKYSGKTRQSLATTGFAARLVG
Ga0210399_1027965923300020581SoilVEGETRPIPTLASNSKLFKDSELQHPEGASASESASEIITGLILNNYPGKTRQSLASAGFAARLV
Ga0210391_1066507423300021433SoilTIASNSKLFKYSQLQIPEEASASESASEINTGIPPVDYPGITKQSLAMMGFAARLV
Ga0210390_1092784513300021474SoilSRRKTGICRPIPTLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV
Ga0224544_106705413300023250SoilKARCHCPIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV
Ga0179589_1029509513300024288Vadose Zone SoilTNIVIFTANTGISRPIPTLASNSELHFCNGLQIPEEASASERNTGIRLNNYSGITRQSLAMTGFAACLV
Ga0209131_115811413300026320Grasslands SoilMNRPIPTLASKFKLVKNSYLQKPEEASTSESASEINTPVLLSNYSGKTRQSLATTGFAARLV
Ga0209156_1042369613300026547SoilTLASNFKLHFCNELQQPEGASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV
Ga0209062_100576533300027965Surface SoilMGPIPTLASNSKLHFCNGLQKPEEASASESASEINTGIRLNNYSGITRQSLAMTGFAACL
Ga0302149_103230213300028552BogMRPIPTLASNSKLLFCNELQLPEEASASESASEINTGLILNDYSGKTRQSLATTGFAARLVCLTHQ
Ga0302149_107353523300028552BogPRSIPTLASNSKLHFCNGLQMPEEASASESASEINTGLLLNNCSGKTRQSLATTGFAARLVWLTHQKPRAAS
Ga0302144_1009472523300028560BogTLASNSKLHFCNGLQMPEEVSASESASEIITGLILNNYSGKTRQSLATTGFAARLV
Ga0302156_1047320623300028748BogSIPTLASNSKLHFCNGLQMPEEASASESASEIITGLILNHYPVNTRQSLATTGFAARLV
Ga0265338_1005117963300028800RhizosphereLASNSKLHFCNGLQMPEEVSASESASEINTGLLLNNYSGKTRQSLATTGFAARLV
Ga0265338_1098837513300028800RhizosphereSSVGSIPTLASNSKLLFRNGLQMPEEVSASESASEINTGLLLNNYSGNTRQSLTTTGFAARLVCLTHQRPRAAS
Ga0302197_1041361323300028873BogTLASNSKLLFCNELQLPEEASASESASEINTGLILNDYSGKTRQSLATTGFAARLVCLTH
Ga0302155_1030168813300028874BogTLASNSKLLFCNGLQKPEEASASESASEINTGIPPLDYPGITRQPLAMTGYAARLV
Ga0239581_105982113300029798Freshwater LakeKALCVGSIPTLASNSKLLFCNELQLPEEASASESASEIITGLPLNNYSGKTRQSLATTGYAARLV
Ga0311327_1002956813300029883BogIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLVCLTHQKPRAAS
Ga0311327_1091620913300029883BogASNYKLLFCNGLQIPEVASASESASEIITGLLLNHYPGITRQSLATTGFAARLV
Ga0311329_1092052723300029907BogAVDFEWLVEGGMRPIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLILNNYSGKTRQSLATMGFAARLV
Ga0311361_1113940923300029911BogGSIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLILNNYSGKTRQSLATTGFAARLV
Ga0311359_1001575093300029914BogRCNGGEMRPIPTLASNSKLLFCNELQLPEEASASESASEINTGLILNDYSGKTRQSLATTGFAARLVCLTHQ
Ga0311358_1059351913300029915BogPIPTLASNSKLHFCNGLQKPEEASASESASEINTGILLNNYSGITWQSLATAGFAARLV
Ga0311363_1087843523300029922FenAYLRGNGEEKRPIPTLASNSKLLFCNGLQKPEEASASESASEINTGIPPLDYPGITKQSLAMTGFAARLV
Ga0311363_1139041713300029922FenSSPTTGTNRKLLFFSRLEQPEAASASESASEINTGLKLNQYPDINRQSLAMTGFAARPV
Ga0311346_1023303233300029952BogRPRSIPTLASNSKLHFCNGLQMPEEASASESASEIITGLLLNHYPVNTRQSLATTGFAARLV
Ga0311343_1076415113300029953BogWASHSPIPTLASNSKLFKYSELQHPEGASASESASEIITGLLLNNYPGKTRQSLATAGFAARLV
Ga0311343_1108150323300029953BogYLNCKRGDKWPIPTLASKSKLLKYSYLQKPEEASASESASEINTGLRLNNCSGKTRQPLATTGYAVRLV
Ga0311331_1129010823300029954BogLASNSHLFKNSELQHPEGASASESASEIITGLLLNNYPGKTRQSLATAGFAARLV
Ga0311342_1088268223300029955BogAKASSVGSIPTLASNSKLFKYSELQHPEGASASESASEIITGLLLNNYPGKTRQSLATAGFAARLV
Ga0302188_1046448723300029986BogKIWPIPTPASNSKLLFCNWLQIPEEASASESASEIITGLLLNHYPGITRQSLATTGFAARLV
Ga0311344_1042116013300030020BogHWRGKRGDKWPIPTLASNSKLHFCNGLQIPEEASASESASEIITGLLLNHYPVNTRQSLATTGFAARLV
Ga0302176_1023888823300030057PalsaNQAYLRRNGGKIWPIPTLASNSKLLKRNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV
Ga0302192_1001985963300030507BogLVDGGKRPIPTPASNSKLLFCNGLQIPEVASASESASEIITGLLLNHYPGITRQSLATTGFAARLV
Ga0311372_1132873413300030520PalsaVGSIPTLASNSKLLFCNGLQKPEEASASESASEINTGIPPLDYPGITKQSLAMTGFAARL
Ga0311345_1038446213300030688BogVNQGIEADSRGRPRSIPTLASNSKLHFCNGLQMPEEASASESASEIITGLLLNHYPVNTRQSLATTGFAARLV
Ga0302310_1049393813300030737PalsaKAVCVGSIPTLASNSKLRFCNGLQMPEEVSASESASEIITGLKLSNYSGITRPSLATTGFAARLV
Ga0075388_1126637423300030848SoilVEGGTRPIPTLASNLKLFKYSELQQPEGASASESASEIITGLLLNNYPGKTRQSLATTGFAARLV
Ga0170822_1008286323300031122Forest SoilGGNCGVVDFEKLPWPCSIPTLASNSKLHFCNGLRIPEEASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV
Ga0302325_1044668813300031234PalsaMSRPIPTLASNSKLLFCNELQLPEEASASESASEIITGLKLSNYSGITRPSLATTGFAARSV
Ga0302324_10280857623300031236PalsaPHRPIPTLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV
Ga0302320_1031486013300031524BogLSPIPTLASNSKLHFCNGLQMPEEASASESASEIITGLLLNHYPVNTRQSLATTGFAARL
Ga0302320_1119708023300031524BogIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNYYSGKTRQSLATTGFAARLVCLTHQRPRAVS
Ga0302326_1077618513300031525PalsaRLWRNRPIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARLV
Ga0302326_1356642423300031525PalsaIPTLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV
Ga0265313_1015053113300031595RhizosphereKASSVGSIPTLASNSKLLFRNGLQMPEEVSASESASEINTGLLLNNYSGKTRQSLATTGFAARLV
Ga0310686_11436543813300031708SoilMADAVRKVLISEESWLFLHTNRAHICPIPTLASNSKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV
Ga0310686_11451361713300031708SoilMRPIPTLASNSKLHFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARL
Ga0302319_1002576413300031788BogVEGGTRPIPTLASNSKLHFCNGLQMPEEASASESASEIITGLLLNHYPVNTRQSLATTGFAARLV
Ga0315295_1043574223300032156SedimentSIPTLASNSKLLFCNELQLPEEASASESASEIITGQLLNNYSGKTRQSLATTGYAARLV
Ga0315283_1028044223300032164SedimentVEGETRSIPTLASNSKLLFGNELQIPEEASASESASEIITGLLLNNYSGKTRQSLATTGFAARLV
Ga0315270_1048920913300032275SedimentNKPCFNRQQGISRPIPTLASNSKLHFCNGLQIPEEASASESASEINTGIRLNNYSGITRQSLAMTGFAARLV
Ga0334804_116766_502_6813300033818SoilPIPTLASNSKLHFCNGLQIPEEASASESASEIITGLLLNHYPVNTRQSLATTGFAARLV
Ga0334816_032191_840_10103300033819SoilTLASNSKLQFCNGLQMPEEASASESASEIITGLRLNNYSGITRQSLAMTGFAARLV
Ga0334850_077874_164_3613300033828SoilVEDETRSIPTLASISKLLKSNELQTPEEASASESASEISTAVKLKYYPGITRPSLATTGFAARLV
Ga0334854_064281_77_2833300033829SoilLRRNGGKIWPIPTLASNSKLLKRNELQTPEEASASESASEISTAVKLKYYPGITRQSLATTGFAARLV
Ga0314861_0504064_318_5183300033977PeatlandQKSGLNGSIPTLASNSKLLKGSELQKSEEASASESASEINTGLLLNNCSGKTRQSLATTGFAARLV
Ga0334827_100970_3_1883300034065SoilVRPIPTLASNSKLRFCNGLQMPEEVSASESASEIITGLLLNNYSGKTRQSLATTGFAARL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.