| Basic Information | |
|---|---|
| Family ID | F099672 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPRRPRRTADVHRLEIR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.35 % |
| % of genes near scaffold ends (potentially truncated) | 17.48 % |
| % of genes from short scaffolds (< 2000 bps) | 52.43 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.466 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.184 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.26% β-sheet: 0.00% Coil/Unstructured: 89.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01638 | HxlR | 30.10 |
| PF03061 | 4HBT | 17.48 |
| PF00883 | Peptidase_M17 | 7.77 |
| PF00171 | Aldedh | 5.83 |
| PF09084 | NMT1 | 2.91 |
| PF07963 | N_methyl | 1.94 |
| PF02789 | Peptidase_M17_N | 1.94 |
| PF01012 | ETF | 1.94 |
| PF02310 | B12-binding | 1.94 |
| PF13560 | HTH_31 | 1.94 |
| PF13439 | Glyco_transf_4 | 1.94 |
| PF04314 | PCuAC | 0.97 |
| PF00132 | Hexapep | 0.97 |
| PF12710 | HAD | 0.97 |
| PF12850 | Metallophos_2 | 0.97 |
| PF02518 | HATPase_c | 0.97 |
| PF12840 | HTH_20 | 0.97 |
| PF14602 | Hexapep_2 | 0.97 |
| PF00437 | T2SSE | 0.97 |
| PF13657 | Couple_hipA | 0.97 |
| PF02749 | QRPTase_N | 0.97 |
| PF00005 | ABC_tran | 0.97 |
| PF10432 | bact-PGI_C | 0.97 |
| PF13180 | PDZ_2 | 0.97 |
| PF02384 | N6_Mtase | 0.97 |
| PF00108 | Thiolase_N | 0.97 |
| PF03308 | MeaB | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 30.10 |
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 9.71 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 5.83 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 5.83 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 5.83 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.91 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.91 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 1.94 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 1.94 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.97 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.97 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.97 |
| COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.47 % |
| Unclassified | root | N/A | 15.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_101699069 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300002568|C688J35102_118517591 | Not Available | 567 | Open in IMG/M |
| 3300003267|soilL1_10104547 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
| 3300004153|Ga0063455_100019394 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300005327|Ga0070658_10016674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5880 | Open in IMG/M |
| 3300005327|Ga0070658_11337392 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005329|Ga0070683_100052837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3765 | Open in IMG/M |
| 3300005332|Ga0066388_102365261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 963 | Open in IMG/M |
| 3300005354|Ga0070675_100000053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 70601 | Open in IMG/M |
| 3300005367|Ga0070667_101031700 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005436|Ga0070713_100000009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 153056 | Open in IMG/M |
| 3300005436|Ga0070713_100099822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2512 | Open in IMG/M |
| 3300005438|Ga0070701_10638070 | Not Available | 710 | Open in IMG/M |
| 3300005439|Ga0070711_100047823 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300005577|Ga0068857_100437967 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300005578|Ga0068854_100000031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 107298 | Open in IMG/M |
| 3300005578|Ga0068854_101644114 | Not Available | 586 | Open in IMG/M |
| 3300005834|Ga0068851_10004510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6282 | Open in IMG/M |
| 3300005844|Ga0068862_101038412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
| 3300005891|Ga0075283_1117072 | Not Available | 509 | Open in IMG/M |
| 3300006175|Ga0070712_100001362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 14813 | Open in IMG/M |
| 3300006755|Ga0079222_10130345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1389 | Open in IMG/M |
| 3300006804|Ga0079221_11592718 | Not Available | 528 | Open in IMG/M |
| 3300009098|Ga0105245_10008767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8821 | Open in IMG/M |
| 3300009101|Ga0105247_10378699 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300009177|Ga0105248_10230059 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300009840|Ga0126313_10000425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 19838 | Open in IMG/M |
| 3300010036|Ga0126305_10305467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300010044|Ga0126310_10046886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2377 | Open in IMG/M |
| 3300010045|Ga0126311_10005122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6949 | Open in IMG/M |
| 3300010400|Ga0134122_10285018 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300012395|Ga0134044_1127480 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012902|Ga0157291_10274287 | Not Available | 572 | Open in IMG/M |
| 3300012908|Ga0157286_10292658 | Not Available | 592 | Open in IMG/M |
| 3300012909|Ga0157290_10000859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4163 | Open in IMG/M |
| 3300012911|Ga0157301_10309252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 580 | Open in IMG/M |
| 3300012915|Ga0157302_10053051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1153 | Open in IMG/M |
| 3300012939|Ga0162650_100000026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 15576 | Open in IMG/M |
| 3300012941|Ga0162652_100051298 | Not Available | 672 | Open in IMG/M |
| 3300012955|Ga0164298_10429534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 863 | Open in IMG/M |
| 3300012960|Ga0164301_10000414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12298 | Open in IMG/M |
| 3300012960|Ga0164301_10004314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5092 | Open in IMG/M |
| 3300012961|Ga0164302_10000625 | All Organisms → cellular organisms → Bacteria | 10187 | Open in IMG/M |
| 3300012987|Ga0164307_10094066 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300012987|Ga0164307_11718242 | Not Available | 532 | Open in IMG/M |
| 3300013307|Ga0157372_10000308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 54161 | Open in IMG/M |
| 3300014310|Ga0075331_1153462 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300014326|Ga0157380_10000059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 62280 | Open in IMG/M |
| 3300014326|Ga0157380_11606519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300014487|Ga0182000_10193953 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300015200|Ga0173480_10079263 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300015359|Ga0134085_10503427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300018432|Ga0190275_10000065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 132765 | Open in IMG/M |
| 3300018465|Ga0190269_10915856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300018465|Ga0190269_11747374 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018465|Ga0190269_12002257 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018476|Ga0190274_11309518 | Not Available | 811 | Open in IMG/M |
| 3300018481|Ga0190271_10002512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11160 | Open in IMG/M |
| 3300018920|Ga0190273_10000868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10943 | Open in IMG/M |
| 3300019767|Ga0190267_10000251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11798 | Open in IMG/M |
| 3300020154|Ga0196965_1143953 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300020181|Ga0196958_10004488 | All Organisms → cellular organisms → Bacteria | 4041 | Open in IMG/M |
| 3300020181|Ga0196958_10229859 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300020181|Ga0196958_10420468 | Not Available | 510 | Open in IMG/M |
| 3300021184|Ga0196959_10103197 | Not Available | 657 | Open in IMG/M |
| 3300021363|Ga0193699_10121307 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300022899|Ga0247795_1003595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2535 | Open in IMG/M |
| 3300023070|Ga0247755_1000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 224795 | Open in IMG/M |
| 3300023077|Ga0247802_1000327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3966 | Open in IMG/M |
| 3300023268|Ga0247765_1017317 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300023275|Ga0247776_10001422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7013 | Open in IMG/M |
| 3300024426|Ga0196960_10000545 | All Organisms → cellular organisms → Bacteria | 12527 | Open in IMG/M |
| 3300025321|Ga0207656_10001019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9131 | Open in IMG/M |
| 3300025321|Ga0207656_10006481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4213 | Open in IMG/M |
| 3300025900|Ga0207710_10466091 | Not Available | 653 | Open in IMG/M |
| 3300025909|Ga0207705_11158715 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300025915|Ga0207693_10769529 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300025916|Ga0207663_10008349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5410 | Open in IMG/M |
| 3300025926|Ga0207659_10000010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 286639 | Open in IMG/M |
| 3300025928|Ga0207700_10000025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 147429 | Open in IMG/M |
| 3300025928|Ga0207700_10080151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2545 | Open in IMG/M |
| 3300025936|Ga0207670_11226673 | Not Available | 635 | Open in IMG/M |
| 3300025941|Ga0207711_10711093 | Not Available | 937 | Open in IMG/M |
| 3300025944|Ga0207661_10022470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4752 | Open in IMG/M |
| 3300025986|Ga0207658_10833332 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300026116|Ga0207674_10057807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3931 | Open in IMG/M |
| 3300027787|Ga0209074_10101657 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300028380|Ga0268265_11519922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 673 | Open in IMG/M |
| 3300028712|Ga0307285_10000009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 116632 | Open in IMG/M |
| 3300028721|Ga0307315_10056929 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300028722|Ga0307319_10000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 329528 | Open in IMG/M |
| 3300028768|Ga0307280_10000029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 37832 | Open in IMG/M |
| 3300028872|Ga0307314_10004550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2903 | Open in IMG/M |
| 3300028876|Ga0307286_10026356 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300030510|Ga0268243_1067235 | Not Available | 797 | Open in IMG/M |
| 3300031938|Ga0308175_100001604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 15284 | Open in IMG/M |
| 3300032080|Ga0326721_10000001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642930 | Open in IMG/M |
| 3300032174|Ga0307470_10284150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1113 | Open in IMG/M |
| 3300032205|Ga0307472_100719648 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300034131|Ga0334911_000048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7368 | Open in IMG/M |
| 3300034132|Ga0334915_000033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 64058 | Open in IMG/M |
| 3300034135|Ga0334929_020507 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300034687|Ga0334905_000798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 5.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 1.94% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.97% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020154 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20 | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300024426 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034131 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMS | Environmental | Open in IMG/M |
| 3300034132 | Biocrust microbial communities from Mojave Desert, California, United States - 11HMC | Environmental | Open in IMG/M |
| 3300034135 | Biocrust microbial communities from Mojave Desert, California, United States - 25HNC | Environmental | Open in IMG/M |
| 3300034687 | Soil microbial communities from Mojave Desert, California, United States - 1NOC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1016990692 | 3300000956 | Soil | MRLIPRNRHQHRSRKTRIAITEAEISADLHYPAQPREPRRGDERRLAIR* |
| C688J35102_1185175912 | 3300002568 | Soil | MRLIPRHRHQQRHRKSPISITEAEISADLHYPVAPRPQRTSAARRLQVR* |
| soilL1_101045472 | 3300003267 | Sugarcane Root And Bulk Soil | MRLIPRTRNRHRNAKTRIAITEAEISADLHYPAQPREQRRLKSSKRS* |
| Ga0063455_1000193944 | 3300004153 | Soil | MRLIPRHRHQQRPRKSLISITEAEISADLHYPASRRPQRTSDARRLGVR* |
| Ga0070658_100166742 | 3300005327 | Corn Rhizosphere | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRSADDVQRLELR* |
| Ga0070658_113373921 | 3300005327 | Corn Rhizosphere | MRLISWHRHQRREKEPWIAISEAEISADLHYPAAPRQRAGAAARRPAVR* |
| Ga0070683_1000528374 | 3300005329 | Corn Rhizosphere | MRLIPRHRHHRRPKSARIAISEAEISADLHYPASARRPRRTAGGQRLEIR* |
| Ga0066388_1023652613 | 3300005332 | Tropical Forest Soil | MRLIPRHRQHRRSRSPQIEISEAEISADLHYPAQRRPSQAPTVVRRIEIR* |
| Ga0070675_10000005318 | 3300005354 | Miscanthus Rhizosphere | MRLIPRHRHNRPPRGPRIAISEAEISADLHYPASRRATRRESAGRRLEAK* |
| Ga0070667_1010317002 | 3300005367 | Switchgrass Rhizosphere | MRLIPRHRQHRRPKAARIAISEAEISADLHYPAQPSRPRRTADVQRLEIR* |
| Ga0070713_10000000928 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRPRQHRRSKSPQIEISEAEISADLHYPAAQRRQFPTIVRRIEIR* |
| Ga0070713_1000998223 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRHRHNRRTRSPQISISEAEISADLHYPASQRRPQSANVVRRIEIR* |
| Ga0070701_106380701 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | IPRHRHHRRAKGPRIAISEAEISADLHYPARPQRPRRSAEDVQRLGLR* |
| Ga0070711_1000478233 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLIPRHRHNRRTRSPQISISEAEISADLHYPASQRRAQYPAVVRRIEVR* |
| Ga0068857_1004379672 | 3300005577 | Corn Rhizosphere | MRLIPRHRHPRRAKGPRIAISEAEISADLHYPASARRPRRTAADQRLEIK* |
| Ga0068854_10000003137 | 3300005578 | Corn Rhizosphere | MRLIPRHRHQQRHSKSRISITEAEISADLHYPAAAREPRRTADHRRLEVR* |
| Ga0068854_1016441141 | 3300005578 | Corn Rhizosphere | MRLIPRHRYHRRPKGPRIAISEAEISADLHYPAQPQRPRRSAEDVQRPG |
| Ga0068851_100045104 | 3300005834 | Corn Rhizosphere | MRLIPRHRQHRRPKGPRIAISEAEISADLHYPAQPRPPRRGADDVQRLELR* |
| Ga0068862_1010384121 | 3300005844 | Switchgrass Rhizosphere | MRLIPRHRHQHRQKRPYIAISEAEISADLHYPAQPRQPRRTAD |
| Ga0075283_11170722 | 3300005891 | Rice Paddy Soil | MRLIPRHRQHRAKAPRIAISEAEISADLHYPAPPRPQRQADV |
| Ga0070712_10000136218 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRHRHHRRPKGARIAISEAEISADLHYPASARRPRRTAGGQRLEIR* |
| Ga0079222_101303453 | 3300006755 | Agricultural Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPSRPRRTADVHRLEVR* |
| Ga0079221_115927181 | 3300006804 | Agricultural Soil | DWRLQMRLIPRHRHHRRPRGPRIAISEAEISADLHYPASARRPRRTADVQRLEIR* |
| Ga0105245_100087677 | 3300009098 | Miscanthus Rhizosphere | MRLIPRHRHPQRHSKSRISITEAEISADLHYPAAPREPRRTADHRRLGVR* |
| Ga0105247_103786992 | 3300009101 | Switchgrass Rhizosphere | MRLISHRNHRRPKDPRIAISEAEISADLHYPAQPQRPRRGADDVPRLELR* |
| Ga0105248_102300592 | 3300009177 | Switchgrass Rhizosphere | MRLIPRHRHHRRPKAARIAISEAEISADLHYPAQPSRPRRSADLQRLEIR* |
| Ga0126313_1000042519 | 3300009840 | Serpentine Soil | MRLIPRHRQHRRPKGPRIAISEAEISADLHYPAQPAKPRRADQRLEAR* |
| Ga0126305_103054672 | 3300010036 | Serpentine Soil | MRLIPRHRHQRRPKGARIAISEAEISADLHYPASPRRPRQTADAQRLGVR* |
| Ga0126310_100468864 | 3300010044 | Serpentine Soil | MRLIPRHRHHRRSKGPQIAISEAEISADLHYPASARQPRRAADAQRLEVR* |
| Ga0126311_100051227 | 3300010045 | Serpentine Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRSDDHVQRLELR* |
| Ga0134122_102850183 | 3300010400 | Terrestrial Soil | MRLIPRHRHHRRSKGPRIAISEAEISADLHYPAQPRRPRRTADVHRLEIR* |
| Ga0134044_11274803 | 3300012395 | Grasslands Soil | HRRPKGPRIAISEAEISADLHYPASRPRARRTADAQRLPVR* |
| Ga0157291_102742872 | 3300012902 | Soil | MRLIPRNRHQRHRKTRIAITEAEISADLHYPAPPRGRQRSANARRLEVR* |
| Ga0157286_102926581 | 3300012908 | Soil | MRLIPRHRHQQRHRRSRIEISEAEISADLHYPAAPREARRTVDASRAQVR* |
| Ga0157290_100008593 | 3300012909 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVHRLEIR* |
| Ga0157301_103092522 | 3300012911 | Soil | PRIAISEAEISADLHYPASARRPRRTADVQRLEVR* |
| Ga0157302_100530512 | 3300012915 | Soil | MEAQMRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVHRLEIR* |
| Ga0162650_10000002611 | 3300012939 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVQRLEVR* |
| Ga0162652_1000512981 | 3300012941 | Soil | MRLISKNRHNRRSKGPRIAISEAEISADLHYPAAPRQPRRTADLRRLEVR* |
| Ga0164298_104295342 | 3300012955 | Soil | MRLIPRHRQQRRPKGPRIAISEAEISADLHYPAQPQRPRRAADVHRLEIR |
| Ga0164301_100004149 | 3300012960 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPSRPRRTADLQRLEIR* |
| Ga0164301_100043143 | 3300012960 | Soil | MRLIPRHRHQRRPKGPRIAISEAEISADLHYPAQPHRPRRTADAHRLEIR* |
| Ga0164302_100006259 | 3300012961 | Soil | MRLIPRHRQHRRPKAARIAISEAEISADLHYPAQPSRPRRSADVQRLEIR* |
| Ga0164307_100940663 | 3300012987 | Soil | MRLIPRHRHNRRTRSPQISISEAEISADRHYPASQRRPQSANVVRRIEIR* |
| Ga0164307_117182421 | 3300012987 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRSADDIQRLELR* |
| Ga0157372_1000030820 | 3300013307 | Corn Rhizosphere | MRLIPRHRHPQRHGKSRISITEAEISADLHYPAAAAREPRRTADHRRLEVR* |
| Ga0075331_11534622 | 3300014310 | Natural And Restored Wetlands | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVQRLEIR* |
| Ga0157380_1000005956 | 3300014326 | Switchgrass Rhizosphere | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPRRPDRTADVHRLEIR* |
| Ga0157380_116065192 | 3300014326 | Switchgrass Rhizosphere | MRLIPRHRHDRRPKGPRIAISEAEISADLHYPAQPPRPRRSADVQRVVVR* |
| Ga0182000_101939532 | 3300014487 | Soil | MRLIHRHRHQQRGKRSLISITEAEISADLHYPAPAREGRRTADARRLQVRSAATA* |
| Ga0173480_100792633 | 3300015200 | Soil | MRLIPRHRHHRRLKGPRIAISEAEISADLHYPAQPRPPRRAANAHRLEIR* |
| Ga0134085_105034272 | 3300015359 | Grasslands Soil | MRLIRHRNHRRPKGPRIAISEAEISADLHYPAPRRPQRTSDARRLQAR* |
| Ga0190275_10000065129 | 3300018432 | Soil | MRLIPRNRHDQRNRKTRIAISEAEISADLHYPAAPRQARRTAERRRLEAR |
| Ga0190269_109158562 | 3300018465 | Soil | MRLISRHRQHRRHKGPRIAISEAEISADLHYPAAPRQPRRTADLRRLEVR |
| Ga0190269_117473741 | 3300018465 | Soil | MRLLHKNRHQHRNRKTRIAISEAEISADLHYPAAPRQPRRTENLRRLEVR |
| Ga0190269_120022572 | 3300018465 | Soil | MRLIPRHRHQHRERKPRIAISEAEISADLHYPAPARQPRRGTDARKLEIR |
| Ga0190274_113095181 | 3300018476 | Soil | MRLIPRHRQQRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVHRLEIR |
| Ga0190271_100025123 | 3300018481 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVHRLEIR |
| Ga0190273_100008689 | 3300018920 | Soil | MRLISRQRHQQRQRKSRIAITEAEIAADLHYPAPREPRRTDGQRRPGVR |
| Ga0190267_1000025111 | 3300019767 | Soil | MRLIPRHRHQQRHQKPSISITEAEISADLHYPASRQPRRTADAPRQQIR |
| Ga0196965_11439532 | 3300020154 | Soil | MRLIHRNRHQQRNRKTRIAISEAEISADLHYPAAPRQPRRNADHRRLEAR |
| Ga0196958_100044883 | 3300020181 | Soil | MRLITRNRHQNRNRKPRIAISEAEISADLHYPASRPQPRQTADLRRLEVR |
| Ga0196958_102298592 | 3300020181 | Soil | MRLISKNRQQQRNRKTRIAISEAEISADLHYPATLREPRRTADLRRLEVR |
| Ga0196958_104204681 | 3300020181 | Soil | WHQHRQRKPRIAISEAEISADLHYPAQPREPRRTANARRLEIR |
| Ga0196959_101031971 | 3300021184 | Soil | RNRKTRIAISEAEISADLHYPATLREPRRTADLRRLEVR |
| Ga0193699_101213072 | 3300021363 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPQRPRRSADDVQRMELR |
| Ga0247795_10035955 | 3300022899 | Soil | MRLIPRHRHHRRHKGPRIAISEAEISADLHYPAAPRQARRTADARRLEIR |
| Ga0247755_100000547 | 3300023070 | Plant Litter | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPRRPRRTADVHRLEIR |
| Ga0247802_10003274 | 3300023077 | Soil | MRLIPRHRHRRRRRGPRIAISEAEISADLHYPSSRVAARRESFGRRLEAK |
| Ga0247765_10173173 | 3300023268 | Plant Litter | MRLIPRHRHHRRVKGPRIAISVAEISADLHYPAQPQRPRRSAGDVQRLGLR |
| Ga0247776_100014229 | 3300023275 | Plant Litter | MRLIPRHRHQRRPKGPRIAISEAEISADLHYPAQPQRPRRTADVHRLDVR |
| Ga0196960_100005455 | 3300024426 | Soil | MRLIGRHRHQHRERKPRIAISEAEISADLHYPARQREPRQTANARRLEIR |
| Ga0207656_100010193 | 3300025321 | Corn Rhizosphere | MRLIPRHRHQQRHSKSRISITEAEISADLHYPAAAREPRRTADHRRLEVR |
| Ga0207656_100064815 | 3300025321 | Corn Rhizosphere | MRLIPRHRQHRRPKGPRIAISEAEISADLHYPAQPRPPRRGADDVQRLELR |
| Ga0207710_104660912 | 3300025900 | Switchgrass Rhizosphere | HHRRPKGPRIAISEAEISADLHYPAQPQRPRRGADDVPRLELR |
| Ga0207705_111587151 | 3300025909 | Corn Rhizosphere | MRLISWHRHQRREKEPWIAISEAEISADLHYPAAPRQRAGAAAARRPAVR |
| Ga0207693_107695292 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRHRHHRRPKGARIAISEAEISADLHYPASARRPRRTAGGQRLEIR |
| Ga0207663_100083493 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRHRHNRRTRSPQISISEAEISADLHYPASQRRAQYPAVVRRIEVR |
| Ga0207659_10000010281 | 3300025926 | Miscanthus Rhizosphere | MRLIPRHRHNRPPRGPRIAISEAEISADLHYPASRRATRRESAGRRLEAK |
| Ga0207700_1000002528 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRPRQHRRSKSPQIEISEAEISADLHYPAAQRRQFPTIVRRIEIR |
| Ga0207700_100801514 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLIPRHRHNRRTRSPQISISEAEISADLHYPASQRRPQSANVVRRIEIR |
| Ga0207670_112266731 | 3300025936 | Switchgrass Rhizosphere | RLIPRHRHNRRTRSPQISISEAEISADLHYPASQRRPQSPNVVRRIEIR |
| Ga0207711_107110932 | 3300025941 | Switchgrass Rhizosphere | MRLIPRHRHHRRPKAARIAISEAEISADLHYPAQPSRPRRSADLQRLEIR |
| Ga0207661_100224702 | 3300025944 | Corn Rhizosphere | MRLIPRHRHHRRPKSARIAISEAEISADLHYPASARRPRRTAGGQRLEIR |
| Ga0207658_108333322 | 3300025986 | Switchgrass Rhizosphere | MRLIPRHRQHRRPKAARIAISEAEISADLHYPAQPSRPRRTADVQRLEIR |
| Ga0207674_100578072 | 3300026116 | Corn Rhizosphere | MRLIPRHRHPRRAKGPRIAISEAEISADLHYPASARRPRRTAADQRLEIK |
| Ga0209074_101016573 | 3300027787 | Agricultural Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPAQPSRPRRTADVHRLEVR |
| Ga0268265_115199221 | 3300028380 | Switchgrass Rhizosphere | MRLIPRHRHQHRQKRPYIAISEAEISADLHYPAQPRQPRRTADL |
| Ga0307285_10000009108 | 3300028712 | Soil | MRLIPRHRHPRRSNGPRIAISEAEISADLHYPANREAARRASAGRRLEAR |
| Ga0307315_100569291 | 3300028721 | Soil | RHRRPKRSRIAISEAEISADLHYPALSPEQRRDVAARRLELR |
| Ga0307319_10000002133 | 3300028722 | Soil | MRLIPRHRHHRRPKGPRIAISEAEISADLHYPASARRPRRTADVQRLEVR |
| Ga0307280_1000002926 | 3300028768 | Soil | MRLIPRHRHHRRAKGPRIAISEAEISADLHYPAQPQRPRRTADVQRLEIR |
| Ga0307314_100045503 | 3300028872 | Soil | MRLIPRHRHPSRAKQPRIAISEAEISADLHYPAPPRRARGSAARRTGLR |
| Ga0307286_100263561 | 3300028876 | Soil | MRLIPRHRHPRRSNGPRIAISEAEISADLHYPANREAARRASAGRRLE |
| Ga0268243_10672353 | 3300030510 | Soil | RPKGPRIAISEAEISADLHYPASPPRPRRTADVQRLEVR |
| Ga0308175_10000160411 | 3300031938 | Soil | MRLISWHRNLRREKEPRIAISEAEISADLHYPAAPRQRAGATTARRPVIR |
| Ga0326721_10000001494 | 3300032080 | Soil | MRLISRNRHQRRSKGPRIAISEAEISADLHYPAAPRQPRRTADLRRLEVR |
| Ga0307470_102841501 | 3300032174 | Hardwood Forest Soil | MRLIPRHRHHRRSKGPRIAISEAEISADLHYPAQPRQPRRSADPQRLELR |
| Ga0307472_1007196481 | 3300032205 | Hardwood Forest Soil | ALSRVASCNQVDWRPRMRLIPRHRHSRRTRSPQISISEAEISADLHYPASQPRPQSANVVRRIEIR |
| Ga0334911_000048_3824_3973 | 3300034131 | Sub-Biocrust Soil | MRLIPRHRHQQRHQKPAISITEAEISADLHYPASRQPRRTADAPRQQIR |
| Ga0334915_000033_37933_38085 | 3300034132 | Hypolithic Biocrust | MRLIPRHRHQRRPKGPRIAISEAEISADLHYPATARRQRRRGDGQRLEIR |
| Ga0334929_020507_348_497 | 3300034135 | Hypolithic Biocrust | MRLIPRHRHQQRHQKPAISITEAEISADLHYPASRQPRRTADAPRHQIR |
| Ga0334905_000798_1754_1909 | 3300034687 | Soil | MRLIHNRNRHQQRQKRTLIAITEAEISADLHYPATSTQARRSADARRPQVR |
| ⦗Top⦘ |