Basic Information | |
---|---|
Family ID | F099659 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | QIRGALEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPG |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 88.35 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.204 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (16.505 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.864 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.631 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00977 | His_biosynth | 4.85 |
PF13517 | FG-GAP_3 | 3.88 |
PF13641 | Glyco_tranf_2_3 | 3.88 |
PF00072 | Response_reg | 1.94 |
PF13620 | CarboxypepD_reg | 1.94 |
PF00990 | GGDEF | 1.94 |
PF00691 | OmpA | 1.94 |
PF02894 | GFO_IDH_MocA_C | 1.94 |
PF12679 | ABC2_membrane_2 | 0.97 |
PF06439 | 3keto-disac_hyd | 0.97 |
PF13551 | HTH_29 | 0.97 |
PF13414 | TPR_11 | 0.97 |
PF02563 | Poly_export | 0.97 |
PF02310 | B12-binding | 0.97 |
PF07638 | Sigma70_ECF | 0.97 |
PF00881 | Nitroreductase | 0.97 |
PF13340 | DUF4096 | 0.97 |
PF01244 | Peptidase_M19 | 0.97 |
PF00326 | Peptidase_S9 | 0.97 |
PF13537 | GATase_7 | 0.97 |
PF00485 | PRK | 0.97 |
PF00589 | Phage_integrase | 0.97 |
PF02457 | DAC | 0.97 |
PF13292 | DXP_synthase_N | 0.97 |
PF01435 | Peptidase_M48 | 0.97 |
PF11737 | DUF3300 | 0.97 |
PF13545 | HTH_Crp_2 | 0.97 |
PF11138 | DUF2911 | 0.97 |
PF01546 | Peptidase_M20 | 0.97 |
PF00903 | Glyoxalase | 0.97 |
PF13472 | Lipase_GDSL_2 | 0.97 |
PF08281 | Sigma70_r4_2 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.94 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.20 % |
Unclassified | root | N/A | 6.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000546|LJNas_1020685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300004139|Ga0058897_11120717 | Not Available | 787 | Open in IMG/M |
3300004635|Ga0062388_102918480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 504 | Open in IMG/M |
3300005177|Ga0066690_10971720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 536 | Open in IMG/M |
3300005559|Ga0066700_10470487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
3300005614|Ga0068856_100143543 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
3300005947|Ga0066794_10098136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
3300005952|Ga0080026_10048789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
3300006050|Ga0075028_100206205 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300006050|Ga0075028_101092757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300006052|Ga0075029_100070873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2049 | Open in IMG/M |
3300006102|Ga0075015_100870671 | Not Available | 545 | Open in IMG/M |
3300006175|Ga0070712_100272648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
3300006893|Ga0073928_10792006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300006954|Ga0079219_11702837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300009089|Ga0099828_10408665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
3300009524|Ga0116225_1094626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
3300009525|Ga0116220_10405508 | Not Available | 610 | Open in IMG/M |
3300009552|Ga0116138_1214374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300009634|Ga0116124_1046580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1288 | Open in IMG/M |
3300009640|Ga0116126_1041135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
3300009643|Ga0116110_1015549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3026 | Open in IMG/M |
3300009644|Ga0116121_1297551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300009646|Ga0116132_1074294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300009700|Ga0116217_10464796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300009764|Ga0116134_1129640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300009824|Ga0116219_10028454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3382 | Open in IMG/M |
3300009824|Ga0116219_10079611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1920 | Open in IMG/M |
3300009839|Ga0116223_10449143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300010339|Ga0074046_10536439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300010379|Ga0136449_100500023 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
3300010379|Ga0136449_103057619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300010379|Ga0136449_104026106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300010379|Ga0136449_104097119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300010400|Ga0134122_12982773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300012096|Ga0137389_11079409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
3300012986|Ga0164304_10223394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
3300012989|Ga0164305_11699533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300014155|Ga0181524_10342741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300014200|Ga0181526_10152787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
3300017928|Ga0187806_1276412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300017938|Ga0187854_10103864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1329 | Open in IMG/M |
3300017940|Ga0187853_10245357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
3300017940|Ga0187853_10401817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300017941|Ga0187850_10403598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300017943|Ga0187819_10566033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300017946|Ga0187879_10427952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Klenkia → unclassified Klenkia → Klenkia sp. PcliD-1-E | 734 | Open in IMG/M |
3300017946|Ga0187879_10695173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300017996|Ga0187891_1141766 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300018004|Ga0187865_1088505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
3300018017|Ga0187872_10165866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
3300018030|Ga0187869_10519341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300018037|Ga0187883_10042123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2439 | Open in IMG/M |
3300018037|Ga0187883_10451647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300018037|Ga0187883_10555593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300018038|Ga0187855_10915405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300018043|Ga0187887_10723653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300018047|Ga0187859_10680147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300018057|Ga0187858_10356187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300018085|Ga0187772_10493724 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300021170|Ga0210400_10061485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2929 | Open in IMG/M |
3300021171|Ga0210405_11127165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300021178|Ga0210408_10996490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300021402|Ga0210385_11584753 | Not Available | 500 | Open in IMG/M |
3300021407|Ga0210383_10003622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13803 | Open in IMG/M |
3300021407|Ga0210383_11136099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300021479|Ga0210410_10019090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5922 | Open in IMG/M |
3300022557|Ga0212123_10074510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2905 | Open in IMG/M |
3300023088|Ga0224555_1061555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
3300024225|Ga0224572_1025178 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300027545|Ga0209008_1011800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2068 | Open in IMG/M |
3300027565|Ga0209219_1103929 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300027745|Ga0209908_10198781 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300027812|Ga0209656_10404126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300027824|Ga0209040_10391123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300027855|Ga0209693_10601568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300027875|Ga0209283_10825814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300027879|Ga0209169_10142433 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300027889|Ga0209380_10233702 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300028666|Ga0265336_10125429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
3300028780|Ga0302225_10191462 | Not Available | 985 | Open in IMG/M |
3300028781|Ga0302223_10244073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300028906|Ga0308309_11184467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300029882|Ga0311368_10275264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
3300029943|Ga0311340_11456082 | Not Available | 538 | Open in IMG/M |
3300029999|Ga0311339_10090500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3830 | Open in IMG/M |
3300030007|Ga0311338_11560648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 606 | Open in IMG/M |
3300030007|Ga0311338_11630554 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300030058|Ga0302179_10257323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300030058|Ga0302179_10309435 | Not Available | 696 | Open in IMG/M |
3300030058|Ga0302179_10475570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 549 | Open in IMG/M |
3300030707|Ga0310038_10087471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1657 | Open in IMG/M |
3300030739|Ga0302311_10635366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300030815|Ga0265746_1008632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
3300031708|Ga0310686_103875430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
3300031753|Ga0307477_11074136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300031754|Ga0307475_10153355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1830 | Open in IMG/M |
3300031788|Ga0302319_10953776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300032160|Ga0311301_11366826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
3300032160|Ga0311301_11831188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300033402|Ga0326728_11161891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300033798|Ga0334821_063600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300033887|Ga0334790_233554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 16.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.62% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.68% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.91% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.91% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.94% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.97% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.97% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.97% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LJNas_10206852 | 3300000546 | Quercus Rhizosphere | RGALEGITPLAHPSKNQQSIRVIREEVERIEWALKEILPG* |
Ga0058897_111207172 | 3300004139 | Forest Soil | QIRGALDGITPLAHPSKNQQSIRVIREEIDRIESALKEILPR* |
Ga0062388_1029184801 | 3300004635 | Bog Forest Soil | ARLNFICARSHHIRGALEGITPLAHPSKNQQSIRVIREEVERIEWAIKEILPG* |
Ga0066690_109717201 | 3300005177 | Soil | LNFIWDRNHQIRGALEAITPLAHPSKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0066700_104704872 | 3300005559 | Soil | EGIAPSAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0068856_1001435431 | 3300005614 | Corn Rhizosphere | NQIRGALEGITPLAHPSKNQQSIRVIREEVDRIEWAVKEILPG* |
Ga0066794_100981362 | 3300005947 | Soil | IWARNHQIRGAVEGISTLAHPLKNQQSIRVIREEVDKIEWALKEILPS* |
Ga0080026_100487891 | 3300005952 | Permafrost Soil | NHQIRGALEGITPLAHPSKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0075028_1002062051 | 3300006050 | Watersheds | ARNHQIRGALDGITPLAHPLKNQQSIRVIREEVDRIEWALKDILPG* |
Ga0075028_1010927571 | 3300006050 | Watersheds | IRGALEGITPVDHPFKNQQSIRVIREEVDRIEWALKEILPG* |
Ga0075029_1000708731 | 3300006052 | Watersheds | NFIWARNHQIRGALEAITPLAHPSKNQQSIRVIREEVDRIEWALRLLDAGR* |
Ga0075015_1008706712 | 3300006102 | Watersheds | INPLAHPSRNQQSIRVIREEVDRIESALKEILPG* |
Ga0070712_1002726481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LKFIWARSNQIRGALEGITPLAHPSKNQQSIRVIREEVDRIEWAVKEILPG* |
Ga0073928_107920061 | 3300006893 | Iron-Sulfur Acid Spring | QIRDALEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0079219_117028372 | 3300006954 | Agricultural Soil | GALEGITPLAHPAKNQQSIRVIREEVDRIESVLKQILPR* |
Ga0099828_104086651 | 3300009089 | Vadose Zone Soil | FIWDRNHQIRGALEAITPLAHPSKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0116225_10946261 | 3300009524 | Peatlands Soil | ITPLAHPAKNQQSIRVIREEVDRIESALKEILTR* |
Ga0116220_104055082 | 3300009525 | Peatlands Soil | DRNRQIRDALEGVTPLAHPMKNQQSIRVIREEVDRIESALKEISTR* |
Ga0116138_12143741 | 3300009552 | Peatland | QIRGAVEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG* |
Ga0116124_10465801 | 3300009634 | Peatland | GALEGITPMAHPLKNQQSIRVIREEVERIEWALKEILPG* |
Ga0116126_10411354 | 3300009640 | Peatland | WARNHHIRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0116110_10155491 | 3300009643 | Peatland | IWARNHHIRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0116121_12975512 | 3300009644 | Peatland | LEGISPVAHPLKNQQSIRVIREEVDRIEWALKEILPG* |
Ga0116132_10742942 | 3300009646 | Peatland | GALEGITPMAHPLKNQQSIRIIREEVDRIEWALKEILPG* |
Ga0116217_104647962 | 3300009700 | Peatlands Soil | QIRGALEGITPLAHPAKNQQSIRVIREEVDRIESALKEISTR* |
Ga0116134_11296401 | 3300009764 | Peatland | IAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0116219_100284542 | 3300009824 | Peatlands Soil | RGALEAITPLAHPMQNQQSIRVIREEVDRIEWALKEILPS* |
Ga0116219_100796111 | 3300009824 | Peatlands Soil | ITPFAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0116223_104491431 | 3300009839 | Peatlands Soil | NFIWARNHQIRGAVEGITPVAHPFKNQQSIRVIREEVDRIEWALKEILPG* |
Ga0074046_105364391 | 3300010339 | Bog Forest Soil | RLNFIWARNHHIRGAVEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPS* |
Ga0136449_1005000231 | 3300010379 | Peatlands Soil | LNFIWARNHHIRGALEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPG* |
Ga0136449_1030576191 | 3300010379 | Peatlands Soil | IRGALEGITPMAHPLKNQQSIRVIREEVERIEWALKEILPG* |
Ga0136449_1040261061 | 3300010379 | Peatlands Soil | ITPLAHPAKNQQSIRVIREEVDRIEWALKTILPR* |
Ga0136449_1040971191 | 3300010379 | Peatlands Soil | IRGALEGITPLAHPAKNQQSIRVIREEVDRIELALKEILSR* |
Ga0134122_129827731 | 3300010400 | Terrestrial Soil | RGALEGIAPSAHPAKNQQSIRVIREEVDRIEWALKEILPRHGS* |
Ga0137389_110794091 | 3300012096 | Vadose Zone Soil | KERSASLNFIWDRNHQIRGALEAITPLAHPSKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0164304_102233942 | 3300012986 | Soil | FIWARSNQIRGALEGITPLAHPSKNQQSIRVIREEVDRIEWAVKEILPG* |
Ga0164305_116995332 | 3300012989 | Soil | WARNHQIRGALEGIAPSAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0181524_103427411 | 3300014155 | Bog | NFIWARNHHIRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR* |
Ga0181526_101527872 | 3300014200 | Bog | QIRGALEAITPLAHPMQNQQSIRVIREEVDRIEWALKEILPS* |
Ga0187806_12764121 | 3300017928 | Freshwater Sediment | HIRGAVEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0187854_101038641 | 3300017938 | Peatland | IRGAVEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPS |
Ga0187853_102453571 | 3300017940 | Peatland | QIRGAVEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0187853_104018171 | 3300017940 | Peatland | LEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0187850_104035982 | 3300017941 | Peatland | WARNHQIRGALEGINTVAHPLKNQQSIRVIREEVDRIELALKEILPS |
Ga0187819_105660332 | 3300017943 | Freshwater Sediment | WARNHQIRGALEGITPLAHPVKNQQSIRVIREEVDRIELALKEILSR |
Ga0187879_104279521 | 3300017946 | Peatland | AVEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPS |
Ga0187879_106951731 | 3300017946 | Peatland | IWARNHHIRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0187891_11417661 | 3300017996 | Peatland | RGALEGITPMAHPLKNQQSIRVIREEVERIEWALKEILPG |
Ga0187865_10885051 | 3300018004 | Peatland | GITPLAHPAKNQQSIRVIREEVDRIELALKEILPS |
Ga0187872_101658662 | 3300018017 | Peatland | RGAVEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0187869_105193411 | 3300018030 | Peatland | HIRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0187883_100421231 | 3300018037 | Peatland | GAVEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0187883_104516472 | 3300018037 | Peatland | ALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0187883_105555931 | 3300018037 | Peatland | IRGALEGISPVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0187855_109154052 | 3300018038 | Peatland | RNHQIRCALEGITPLAHPAKNQQSIRVIREEVDKIEWALKEILPS |
Ga0187887_107236531 | 3300018043 | Peatland | QIRGALEAITPLAHPMQNQQSIRVIREEVDRIEWALKEILPS |
Ga0187859_106801471 | 3300018047 | Peatland | IWARNHHIRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALNEILPR |
Ga0187858_103561871 | 3300018057 | Peatland | IRGALEGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0187772_104937241 | 3300018085 | Tropical Peatland | NFIWARNHHIRGAVEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0210400_100614851 | 3300021170 | Soil | IRGALEAITPLAHPMQNQQSIRVIREEVDRIEWALKEILPS |
Ga0210405_111271652 | 3300021171 | Soil | ICDRNRQIRGALEAITPLAHPMQNQQSIRVIREEVDRIEWALKEILPS |
Ga0210408_109964902 | 3300021178 | Soil | ERLNFIWARNHHIRGALEGIAPLAHPARNQQSIRVIREEVDRIDWALKEILTR |
Ga0210385_115847531 | 3300021402 | Soil | RGALEGITPLAHPSRNQQSIRVIREEVDRIEWVLKEMLTG |
Ga0210383_100036229 | 3300021407 | Soil | ALEGIAPTAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0210383_111360991 | 3300021407 | Soil | RGALEGIAPTAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0210410_100190908 | 3300021479 | Soil | NFICARNHQIRGALEGLTPLAHPAKNQQSIRVIREEVERIEWALNEILQR |
Ga0212123_100745105 | 3300022557 | Iron-Sulfur Acid Spring | ALEGITPLAHPSKNQQSIRVIREEVDRIEWALKEIMPR |
Ga0224555_10615551 | 3300023088 | Soil | GISPVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0224572_10251782 | 3300024225 | Rhizosphere | ALEGITPLAHPAKNQQSIRVIREEVDRIELALKEILSR |
Ga0209008_10118001 | 3300027545 | Forest Soil | EGITPLAHPSKNQQSIRVIREEVEKIESALKEILPG |
Ga0209219_11039291 | 3300027565 | Forest Soil | QIRGALDGIAPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0209908_101987812 | 3300027745 | Thawing Permafrost | NHQIRGALEGIAPSAHPAKNQQSIRIIREEVDRIERALKDILPR |
Ga0209656_104041261 | 3300027812 | Bog Forest Soil | HIRGAVEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPS |
Ga0209040_103911232 | 3300027824 | Bog Forest Soil | NHHIRGAVEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPS |
Ga0209693_106015682 | 3300027855 | Soil | NFIFARNHQIRGALGGITPLAHPPKNQQSIRVIREEVERIESALKEILPG |
Ga0209283_108258141 | 3300027875 | Vadose Zone Soil | DLNHQIRGALEAITPLAHPSKNQQSIRVIREEVDRIEWALKEILPR |
Ga0209169_101424333 | 3300027879 | Soil | VEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPS |
Ga0209380_102337021 | 3300027889 | Soil | WDRNHQIRGALEGIAPTAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0265336_101254291 | 3300028666 | Rhizosphere | LEGITPLAHPAKNQQSIRVIREEVDRIELTLKEILSR |
Ga0302225_101914622 | 3300028780 | Palsa | LDGIAPTAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0302223_102440731 | 3300028781 | Palsa | ARLSFIWARNHQIRGALEGITPLAHPAKNQQSIRVIREEVDRIELALKEILSR |
Ga0308309_111844671 | 3300028906 | Soil | IRGALEGIAPTAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0311368_102752643 | 3300029882 | Palsa | RNDQIRGALEGITPLAHPAKNQQSIRVIREEVDRIELALKEILSR |
Ga0311340_114560821 | 3300029943 | Palsa | EAITPLAHPSKNQQSIRVIREEVERIEWAIKEILPG |
Ga0311339_100905001 | 3300029999 | Palsa | FICARNHQIRGALEAITPLAHPMKNQQSIRVIREEVDRIEWALKEILPR |
Ga0311338_115606482 | 3300030007 | Palsa | HRIRGAVEGITPVGHPLKNQQSIRVIREEVDRIEWALKEILPS |
Ga0311338_116305542 | 3300030007 | Palsa | NFIWARNHQIRGALEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0302179_102573232 | 3300030058 | Palsa | ARNHQIRGALEAITPLAHPMKNQQSIRVIREEVDRIEWALKEILPH |
Ga0302179_103094351 | 3300030058 | Palsa | NHHIRGALEGITPLAHPAKNQQSIRVIREEVERIEWALKEILPR |
Ga0302179_104755702 | 3300030058 | Palsa | NFIWARSHKIRGAVEGITPVGHPLKNQQSIRVIREEVDRIEWALKEILPS |
Ga0310038_100874711 | 3300030707 | Peatlands Soil | QIRGALEGITPLAHPAKNQQSIRVIREEVDRIESALKEISTR |
Ga0302311_106353661 | 3300030739 | Palsa | RNHQIRGALEGITPLAHPAKNQQSIRVIREEVDRIELALKEILSR |
Ga0265746_10086323 | 3300030815 | Soil | IWARNHQIRGALDGIAPTAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0310686_1038754301 | 3300031708 | Soil | ALEGITPLAHPSKNQQSIRVIREEVERIEWALKEILPG |
Ga0307477_110741361 | 3300031753 | Hardwood Forest Soil | GALEGITPLAHPAKNQQSIRVIREEVDRIELALKEILSR |
Ga0307475_101533553 | 3300031754 | Hardwood Forest Soil | QIRGALAGIMPLAHPAKNQQSIRVIREEVDRIEWALKEILPR |
Ga0302319_109537761 | 3300031788 | Bog | QIRGALEGITPLAHPAKNQQSIRVIREEVDRIEWALKEILPG |
Ga0311301_113668261 | 3300032160 | Peatlands Soil | VEGITTVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0311301_118311882 | 3300032160 | Peatlands Soil | EGITPVAHPLKNQQSIRVIREEVDRIEWALKEILPG |
Ga0326728_111618911 | 3300033402 | Peat Soil | RNHQIRGAVEGIATVAHPLKNQQSIRVIREETDRIEWALKEILPS |
Ga0334821_063600_574_732 | 3300033798 | Soil | RLNFIWARNHQIRGAVEGIATVAHPLKNQQSIRVIREETDRIEWALKEILPS |
Ga0334790_233554_408_515 | 3300033887 | Soil | GITPLAHPSKNQQSIRVIREEVDRIEWALKEILSR |
⦗Top⦘ |