| Basic Information | |
|---|---|
| Family ID | F099651 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MQEATQPTILSEAADPLAAAAYRAEAWAGEPFLREGE |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.95 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.09 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.641 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.922 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.689 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF05036 | SPOR | 3.88 |
| PF00725 | 3HCDH | 3.88 |
| PF02934 | GatB_N | 0.97 |
| PF14748 | P5CR_dimer | 0.97 |
| PF01182 | Glucosamine_iso | 0.97 |
| PF02737 | 3HCDH_N | 0.97 |
| PF13181 | TPR_8 | 0.97 |
| PF09948 | DUF2182 | 0.97 |
| PF13439 | Glyco_transf_4 | 0.97 |
| PF13424 | TPR_12 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 4.85 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.97 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.97 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.97 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.97 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.64 % |
| Unclassified | root | N/A | 21.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101918532 | Not Available | 541 | Open in IMG/M |
| 3300000953|JGI11615J12901_11983303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 796 | Open in IMG/M |
| 3300001538|A10PFW1_11852190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1049 | Open in IMG/M |
| 3300004081|Ga0063454_100230184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1088 | Open in IMG/M |
| 3300005171|Ga0066677_10757147 | Not Available | 540 | Open in IMG/M |
| 3300005332|Ga0066388_100190415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2666 | Open in IMG/M |
| 3300005336|Ga0070680_101916023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300005456|Ga0070678_100357329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1258 | Open in IMG/M |
| 3300005540|Ga0066697_10787791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300005545|Ga0070695_101331139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300005558|Ga0066698_11044727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300005569|Ga0066705_10675705 | Not Available | 625 | Open in IMG/M |
| 3300005578|Ga0068854_101189129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300005586|Ga0066691_10779113 | Not Available | 564 | Open in IMG/M |
| 3300005587|Ga0066654_10064377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
| 3300005618|Ga0068864_101198733 | Not Available | 758 | Open in IMG/M |
| 3300005891|Ga0075283_1052350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300006032|Ga0066696_10043861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2474 | Open in IMG/M |
| 3300006175|Ga0070712_100531746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 989 | Open in IMG/M |
| 3300006175|Ga0070712_101431097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300006606|Ga0074062_12557741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300006618|Ga0101566_10789326 | Not Available | 559 | Open in IMG/M |
| 3300006854|Ga0075425_102146530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300006954|Ga0079219_10379065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 925 | Open in IMG/M |
| 3300009137|Ga0066709_103074898 | Not Available | 611 | Open in IMG/M |
| 3300009523|Ga0116221_1325990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300009551|Ga0105238_11653100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300010043|Ga0126380_10728973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
| 3300010046|Ga0126384_10785752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300010323|Ga0134086_10156485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300010396|Ga0134126_12442965 | Not Available | 569 | Open in IMG/M |
| 3300010866|Ga0126344_1300599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300011992|Ga0120146_1057735 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300011994|Ga0120157_1061192 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300012198|Ga0137364_10550687 | Not Available | 868 | Open in IMG/M |
| 3300012200|Ga0137382_10297343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1126 | Open in IMG/M |
| 3300012201|Ga0137365_10760358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300012208|Ga0137376_11034708 | Not Available | 703 | Open in IMG/M |
| 3300012351|Ga0137386_10384943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
| 3300012353|Ga0137367_10252696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300012355|Ga0137369_10508497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 850 | Open in IMG/M |
| 3300012357|Ga0137384_10943006 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012358|Ga0137368_10671514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300012359|Ga0137385_10991808 | Not Available | 693 | Open in IMG/M |
| 3300012922|Ga0137394_11328640 | Not Available | 581 | Open in IMG/M |
| 3300012922|Ga0137394_11422603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300012961|Ga0164302_10921399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300013100|Ga0157373_10584272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300013105|Ga0157369_11202311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300014968|Ga0157379_11390078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300015245|Ga0137409_11394964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300017657|Ga0134074_1109955 | Not Available | 950 | Open in IMG/M |
| 3300018064|Ga0187773_10714294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300018481|Ga0190271_13458584 | Not Available | 529 | Open in IMG/M |
| 3300019362|Ga0173479_10901179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300019867|Ga0193704_1018749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
| 3300020062|Ga0193724_1034607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
| 3300021439|Ga0213879_10111516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
| 3300021478|Ga0210402_10903148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
| 3300022467|Ga0224712_10130051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300022756|Ga0222622_10721765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 725 | Open in IMG/M |
| 3300025664|Ga0208849_1025891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1913 | Open in IMG/M |
| 3300025916|Ga0207663_10705839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300025924|Ga0207694_10332275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1256 | Open in IMG/M |
| 3300025929|Ga0207664_11140340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
| 3300025944|Ga0207661_10763192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
| 3300026067|Ga0207678_10879479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300026142|Ga0207698_11217681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
| 3300026300|Ga0209027_1319765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300026318|Ga0209471_1272158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300026527|Ga0209059_1187816 | Not Available | 709 | Open in IMG/M |
| 3300026552|Ga0209577_10090873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2493 | Open in IMG/M |
| 3300027773|Ga0209810_1348689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300027826|Ga0209060_10254831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300028381|Ga0268264_11013092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
| 3300028556|Ga0265337_1141896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300028708|Ga0307295_10071123 | Not Available | 915 | Open in IMG/M |
| 3300028710|Ga0307322_10056769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300028771|Ga0307320_10302488 | Not Available | 635 | Open in IMG/M |
| 3300028784|Ga0307282_10273271 | Not Available | 813 | Open in IMG/M |
| 3300028799|Ga0307284_10152215 | Not Available | 893 | Open in IMG/M |
| 3300028876|Ga0307286_10416155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300030006|Ga0299907_10910007 | Not Available | 653 | Open in IMG/M |
| 3300031199|Ga0307495_10049128 | Not Available | 857 | Open in IMG/M |
| 3300031226|Ga0307497_10109501 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300031239|Ga0265328_10223360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300031242|Ga0265329_10102057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300031711|Ga0265314_10342759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300031751|Ga0318494_10655339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300031754|Ga0307475_10978168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300031819|Ga0318568_10679193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300031820|Ga0307473_11442064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300031910|Ga0306923_12386179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300031938|Ga0308175_100722434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1083 | Open in IMG/M |
| 3300031938|Ga0308175_101901131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300032001|Ga0306922_11570259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300032003|Ga0310897_10490218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300032805|Ga0335078_11470215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300032893|Ga0335069_11783394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300032893|Ga0335069_12001611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300032954|Ga0335083_10454812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
| 3300033486|Ga0316624_11697968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300033803|Ga0314862_0119039 | Not Available | 623 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.88% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006618 | Soil microbial communities from the Leymus chinensis steppe, China - without N addition | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019185322 | 3300000364 | Soil | MQEAIPQPTSSLEAADPVVAAALRAEAWAGEPFLREGEN |
| JGI11615J12901_119833031 | 3300000953 | Soil | MQEAIPQPTSSLEAADPTVAAALRAEAWAGEPFLREGEDPAQA |
| A10PFW1_118521903 | 3300001538 | Permafrost | MQEATQQPTILSAADPIAAAAFRAEAWAGEPFLRDGEDPA |
| Ga0063454_1002301841 | 3300004081 | Soil | MQEATQSTILSEASADPLAAAAVRAEAWAGEPFLRDGEDVAVVL |
| Ga0066677_107571471 | 3300005171 | Soil | MQEIKEQPTTASEATDGLAAAALRAEAWAGEPFLREGEDP |
| Ga0066388_1001904151 | 3300005332 | Tropical Forest Soil | MQEAIQQPTSSTLEATDPVVAAALRAEAWAGEPFLRPDEDA |
| Ga0070680_1019160231 | 3300005336 | Corn Rhizosphere | MQEATQSTILSEATDPLAAAALRAEAWAGEPFLRDGEDVA |
| Ga0070678_1003573291 | 3300005456 | Miscanthus Rhizosphere | MQEIKEQPTTVSEATDGLEAAALRAEAWAGEPFLREGEDPAVS |
| Ga0066697_107877912 | 3300005540 | Soil | MQEAIPQPTSSLEAADPVVAAALRAEAWAGEPFVREG |
| Ga0070695_1013311391 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEAIQQPTSSLEASDPRVASALRAEAWAGEPFLREGENLNEVLA |
| Ga0066698_110447271 | 3300005558 | Soil | MQEATQQPIILSEAADPLAASAYRAEAWAGEPFLREGED |
| Ga0066705_106757052 | 3300005569 | Soil | MQEATEIPTAVSEATDGLTAAALRAEAWAGEPFLH |
| Ga0068854_1011891292 | 3300005578 | Corn Rhizosphere | MQEATQPTILSEAADPLAAAAYRAEAWAGEPFLREGE |
| Ga0066691_107791132 | 3300005586 | Soil | MQETTQIPTAESEATDGLTAAALRAEAWAGEPFLRE |
| Ga0066654_100643774 | 3300005587 | Soil | MQEAIPQPTSSLEAADPTVAAALRAEAWAGEPFVREGED |
| Ga0068864_1011987331 | 3300005618 | Switchgrass Rhizosphere | MQEITEQPTTASEATDGLTADALRAEAWAGEPFLREGED |
| Ga0075283_10523501 | 3300005891 | Rice Paddy Soil | MQEAIQQPTSSTLEAADPVVAAALRAEAWAGEPFVR |
| Ga0066696_100438613 | 3300006032 | Soil | MQEATQPTILSEAADPIAAAAYRAEAWAGEPFLHDG |
| Ga0070712_1005317461 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEAISQPTGPPEAADPVVASAVRAEAWAGEPFLRDGEDPAVS |
| Ga0070712_1014310971 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEAIQPIILSEAADPLAADAYRAEAWAGEPFLRDGEDPAE |
| Ga0074062_125577412 | 3300006606 | Soil | MQEAIQQPTSSLEATDPIVAAALRAEAWAGEPFVREGEDPAE |
| Ga0101566_107893261 | 3300006618 | Soil | MQEIKEQPTATSEATDGLMADALRAEAWAGEPFIREGEDP |
| Ga0075425_1021465302 | 3300006854 | Populus Rhizosphere | VQKITEQPTIAPEALDGLADAAQRAGKWAGEPFLREGEGPEQV |
| Ga0079219_103790651 | 3300006954 | Agricultural Soil | MQEAIPQPTSSLEAADPVVAAALRAEAWAGEPFVREGEDPAQA |
| Ga0066709_1030748982 | 3300009137 | Grasslands Soil | MQEITEQPTITSEATNGLTADALRAEAWAGEPFLREGEEPGKV |
| Ga0116221_13259901 | 3300009523 | Peatlands Soil | MQEAIHQPTTFSEAGDPLAAAAFRAEAWAGEPFLRDGENPAE |
| Ga0105238_116531002 | 3300009551 | Corn Rhizosphere | MQEAIPQPTSSLEAADPRVAAALRAEAWAGEPFLRDGEDP |
| Ga0126380_107289731 | 3300010043 | Tropical Forest Soil | MQEAIQQPTSSLEADDPVVASAHRAEAWAGEPFLREGENPAEAL |
| Ga0126384_107857521 | 3300010046 | Tropical Forest Soil | MQEAIPQPTGPLEAADPVVASALRAEAWAGEPFLRDGEDPA |
| Ga0134086_101564851 | 3300010323 | Grasslands Soil | MQEAIPQPTSSLEAADPTVAAALRAEAWAGEPFVREGEDPAVALGEG |
| Ga0134126_124429651 | 3300010396 | Terrestrial Soil | MTETTETPTIGSEATDGLAAAALRAEAWAGEPFLREGEEPEHAL |
| Ga0126344_13005992 | 3300010866 | Boreal Forest Soil | MQEAIQQTSTFAEASDPLAAAAYRAEAWAGEPFLRDGEDP |
| Ga0120146_10577352 | 3300011992 | Permafrost | MHETIEQPTTSSEAPDGLAAAALRAEAWAGEPFLHAGED |
| Ga0120157_10611921 | 3300011994 | Permafrost | MHETIEQPTTSSEAPDGLAAAALRAEAWAGEPFLHAGEDPATTLAA |
| Ga0137364_105506872 | 3300012198 | Vadose Zone Soil | MQEIKEQPTTASEATDGLVADALRAEAWAGEPFIREGE |
| Ga0137382_102973433 | 3300012200 | Vadose Zone Soil | MQEAIQPTILSEAADQLAAAAYRAETWAGEPFLHDGEDVEKVLAP |
| Ga0137365_107603581 | 3300012201 | Vadose Zone Soil | MQEAIQQPTSLAATDPVVAAALRAEAWAGEPFVREGEDPAEA |
| Ga0137376_110347081 | 3300012208 | Vadose Zone Soil | MQEIKEQPTTASEATDGLTAAALRAEAWAGEPFLREGEDPDRVL |
| Ga0137386_103849431 | 3300012351 | Vadose Zone Soil | MQEATQQPTILSEAADTIAAAAFRAEAWAGEPLLRDGDDPA |
| Ga0137367_102526963 | 3300012353 | Vadose Zone Soil | MQEIKEQPTTASEATDGLTADALRAEAWAGEPFLREGED |
| Ga0137369_105084971 | 3300012355 | Vadose Zone Soil | MQEATQQPTILSEAADPLAALAIRAEAWVGEPFLRDGEDPAE |
| Ga0137384_109430062 | 3300012357 | Vadose Zone Soil | MQEATKPTVISEANDPLAAAALRAEAWAGEPFLRDG |
| Ga0137368_106715142 | 3300012358 | Vadose Zone Soil | MQEATQQPTILSEAADPLAALAIRAEAWVGEPFLRDGEDPAEVLGKLDRKAN |
| Ga0137385_109918082 | 3300012359 | Vadose Zone Soil | MQEIKEQPTTESEATDGLMADALRAEAWAGEPFIREGEDP |
| Ga0137394_113286401 | 3300012922 | Vadose Zone Soil | MQEITEQPTTASEAPDGLMADALRAEAWAGEPFIRE |
| Ga0137394_114226032 | 3300012922 | Vadose Zone Soil | MQEAIQPTILSEAADQLAAAAYRAETWAGEPFLHD |
| Ga0164302_109213992 | 3300012961 | Soil | MQEAIQPIILSEAADPLAADAYRAEAWAGEPFLRDGEDP |
| Ga0157373_105842722 | 3300013100 | Corn Rhizosphere | MQEATQSTILSDAADPLAAAAFRAEAWAGEPFLREGEDVAVVLA |
| Ga0157369_112023112 | 3300013105 | Corn Rhizosphere | MQEATQSTILSDAADPLAAAAFRAEAWAGEPFLREGEEVAVV |
| Ga0157379_113900782 | 3300014968 | Switchgrass Rhizosphere | MQEAIQQPTSSLEASDPRVASALRAEAWAGEPFLREGENLNE |
| Ga0137409_113949642 | 3300015245 | Vadose Zone Soil | MQEATQQPTILSEAADMIAAAAFRAEAWAGEPFLRDGDDPAV |
| Ga0134074_11099552 | 3300017657 | Grasslands Soil | MQEIKEQPTTVSEAPNGLSAAALRAEAWAGEPFLREGEDP |
| Ga0187773_107142942 | 3300018064 | Tropical Peatland | MQEAIQQPTSSLEASDPRVASALRAEAWAGEPFLR |
| Ga0190271_134585842 | 3300018481 | Soil | MQEISEQRTTALEAPGVPADAALAERWAGEPFLRQDEDPAEVLAP |
| Ga0173479_109011791 | 3300019362 | Soil | MQEAIPQPTSSLEAADPVVAAALRAEAWAGEPFLR |
| Ga0193704_10187491 | 3300019867 | Soil | MQEIKEQPTTESEATDGLMADALRAEAWAGEPFIREG |
| Ga0193724_10346071 | 3300020062 | Soil | MQEITEQPTTASEATDGLTADALRAEAWAGEPFLREGE |
| Ga0213879_101115161 | 3300021439 | Bulk Soil | MRAAHMQEAIQHTTPIADAGDPLVDAAYRAEAWAGEPFLRDGEDPA |
| Ga0210402_109031481 | 3300021478 | Soil | MQEAIQQPTSSLEAADPVVAAALRAEAWADEPFIREGE |
| Ga0224712_101300513 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEATQPTILSDAADPLAAAALRAEAWAGEPFLRDGEDV |
| Ga0222622_107217652 | 3300022756 | Groundwater Sediment | MQEIKEQPTTASEATDGLVAAALRAEAWAGEPFLREGED |
| Ga0208849_10258911 | 3300025664 | Arctic Peat Soil | MQEAIQHTTFAEANDPLAAAAYRAEAWAGEPSLRDGEDP |
| Ga0207663_107058392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MQEAIRQPTTLSEASDPLAASAFRAEAWAGEPFLRDGEDP |
| Ga0207694_103322751 | 3300025924 | Corn Rhizosphere | MQEATQPTILSDAADPLAAAALRAEAWAGEPFLRDGEDVAV |
| Ga0207664_111403401 | 3300025929 | Agricultural Soil | MQEAIEPNTLSEAADLLAAAAYRAEAWAGEPFLHEGE |
| Ga0207661_107631921 | 3300025944 | Corn Rhizosphere | MQEATQPTILSEAADPLAAAAYRAEAWAGEPFLREGEDTAQVLA |
| Ga0207678_108794791 | 3300026067 | Corn Rhizosphere | MQEATQPTILSEAADPLAAAAYRAEAWAGEPFLREGEDTAQV |
| Ga0207698_112176811 | 3300026142 | Corn Rhizosphere | MQEAIPQPTSSLEAADPTVAAALRAEAWAGEPFVRE |
| Ga0209027_13197651 | 3300026300 | Grasslands Soil | MQEAIQQPTSSTLEAADPIVAAALRAEAWAGEPFVRE |
| Ga0209471_12721582 | 3300026318 | Soil | MQEAIQQTTTFAEANDPLAAAAYRAEAWAGEPFLRDGE |
| Ga0209059_11878162 | 3300026527 | Soil | MQEAIPQPTSSLEAADPTVAAALRAEAWAGEPFVREGE |
| Ga0209577_100908731 | 3300026552 | Soil | MQEATQPTILSEAADPIAAAAYHAEAWAGEPFLHDGEEPAQVLAAG |
| Ga0209810_13486891 | 3300027773 | Surface Soil | MQEAIQQPTIASEAADPLVAAATRAEAWAGEPFLREGEEPG |
| Ga0209060_102548311 | 3300027826 | Surface Soil | MQEAIHEPTHVPSAADPLVAAAARAEAWAGEPFLRDGEDP |
| Ga0268264_110130921 | 3300028381 | Switchgrass Rhizosphere | MQEAIHEPTHYPSADDPLVAAAARAEAWAGEPFLRDG |
| Ga0265337_11418962 | 3300028556 | Rhizosphere | MQEAIHEPTQPLSAADPLVAAATRAEAWAGEPFLRSGED |
| Ga0307295_100711231 | 3300028708 | Soil | MQEITEQPTTASEAPNGLMADALRAEAWAGEPFIRE |
| Ga0307322_100567693 | 3300028710 | Soil | MQEIKEQPTTASEATDGLVAAALRAEAWAGEPFLRE |
| Ga0307320_103024881 | 3300028771 | Soil | MQEIKEQPTTASEATDGLVASALRAEAWAGEPFLREGEDPA |
| Ga0307282_102732711 | 3300028784 | Soil | MQEIKEHPTTASEVTDGLMADALRAEAWAGEPFIREGEDPAK |
| Ga0307284_101522152 | 3300028799 | Soil | MQEIKEQPTTASEATDGLMADALRAEAWAGEPFIREGEDPAKVLA |
| Ga0307286_104161552 | 3300028876 | Soil | MQEAIRYPTDESEATDGLTAAALRAEPWAGEPFLREGEEPNEVL |
| Ga0299907_109100072 | 3300030006 | Soil | MQEAFPYPTDQSEATGGLAAAALRAQSWAGEPFLQDDEDP |
| Ga0307495_100491281 | 3300031199 | Soil | MQEIKEQPTTESEATDGLMADALRAEAWAGEPFIREGEDPAKV |
| Ga0307497_101095011 | 3300031226 | Soil | MQEAIPQPTSSLEAADPVVAAALRAEAWAGEPFVREGEDPAEA |
| Ga0265328_102233602 | 3300031239 | Rhizosphere | MHEAIHTPTIDSEAADPLVAAAVRAQAWAGEPFLREGEDPAP |
| Ga0265329_101020572 | 3300031242 | Rhizosphere | MQEATQQPTILLAADPLTAAALHAETWAGEAFLRDGEDPTVVLAPG |
| Ga0265314_103427592 | 3300031711 | Rhizosphere | MHEAIHTPTIDSEAADPLVAAAVRAQAWAGEPFLREGEDPAPAFAAG |
| Ga0318494_106553392 | 3300031751 | Soil | MQEVTQQPTIVSEAADPLVAAAYRAEAWAGEPFLREGEDAEQV |
| Ga0307475_109781682 | 3300031754 | Hardwood Forest Soil | MQEAIQQTSTFAEASDPLAAAAYRAETWAGEPFLRD |
| Ga0318568_106791931 | 3300031819 | Soil | MQEAIQQPTSSTLEAADPVVAAALRAEAWAGEPFVREGDDPSET |
| Ga0307473_114420642 | 3300031820 | Hardwood Forest Soil | MQEVTQQPTIVSEAAVPMVAAAYRAEAWAGEPFLR |
| Ga0306923_123861791 | 3300031910 | Soil | MQEAIQQPTSSTLEAADPVVAAALRAEAWAGEPFVREGDDPSE |
| Ga0308175_1007224343 | 3300031938 | Soil | MQEATEPIILPDAADPLAAAALRAEAWAGEPFLRDGE |
| Ga0308175_1019011312 | 3300031938 | Soil | MQEAIPQPTSSLEAADPVVAAALRAEAWAGEPFVREGE |
| Ga0306922_115702592 | 3300032001 | Soil | MQEVTQQPTIVSEAADPLVAAAYRAEAWAGEPFLREGEDAE |
| Ga0310897_104902182 | 3300032003 | Soil | MQEAIEQPTLALEAPDGLAAAALRAEAWAGEPFLHPD |
| Ga0335078_114702152 | 3300032805 | Soil | MQEATQQPTIVTGAADPLVAAAFRAEAWAGEPFLRDG |
| Ga0335069_117833942 | 3300032893 | Soil | MQEAIPQPTGPPEAADPVVASALRAEAWAGEPFLREGED |
| Ga0335069_120016112 | 3300032893 | Soil | MQEAIHDPTMFSGAADPLVAAAFRAEAWAGEPFFREGEDA |
| Ga0335083_104548123 | 3300032954 | Soil | MQEAIRETTTLAEAADALSSAAYRAETWAGEPFLRDGEDAAVVLAPG |
| Ga0316624_116979682 | 3300033486 | Soil | MQEATQQPTIVSGAADPLVAAAFRAEAWAGEPFLR |
| Ga0314862_0119039_510_623 | 3300033803 | Peatland | MQEATEIPTTTSEATDGLTAAALRAEAWAGEPFLRADE |
| ⦗Top⦘ |