NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099638

Metagenome / Metatranscriptome Family F099638

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099638
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 47 residues
Representative Sequence GIECGYRDTEAIDSQLEDFTAAGPREILVHAPDLEAARALLDEAE
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.06 %
% of genes from short scaffolds (< 2000 bps) 95.15 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.524 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(14.563 % of family members)
Environment Ontology (ENVO) Unclassified
(26.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.369 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.03%    β-sheet: 13.70%    Coil/Unstructured: 60.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF09413DUF2007 7.77
PF00903Glyoxalase 7.77
PF09723Zn-ribbon_8 6.80
PF07883Cupin_2 2.91
PF13231PMT_2 1.94
PF07690MFS_1 1.94
PF00035dsrm 1.94
PF03575Peptidase_S51 1.94
PF05496RuvB_N 1.94
PF14079DUF4260 1.94
PF00196GerE 1.94
PF03706LPG_synthase_TM 0.97
PF13185GAF_2 0.97
PF07676PD40 0.97
PF01022HTH_5 0.97
PF13424TPR_12 0.97
PF01872RibD_C 0.97
PF01625PMSR 0.97
PF02518HATPase_c 0.97
PF13340DUF4096 0.97
PF08240ADH_N 0.97
PF00254FKBP_C 0.97
PF03413PepSY 0.97
PF00291PALP 0.97
PF00132Hexapep 0.97
PF08447PAS_3 0.97
PF01545Cation_efflux 0.97
PF13365Trypsin_2 0.97
PF00909Ammonium_transp 0.97
PF00106adh_short 0.97
PF03795YCII 0.97
PF13489Methyltransf_23 0.97
PF00583Acetyltransf_1 0.97
PF01569PAP2 0.97
PF00440TetR_N 0.97
PF00892EamA 0.97
PF01636APH 0.97
PF13673Acetyltransf_10 0.97
PF00027cNMP_binding 0.97
PF02628COX15-CtaA 0.97
PF08327AHSA1 0.97
PF05147LANC_like 0.97
PF13377Peripla_BP_3 0.97
PF03992ABM 0.97
PF12464Mac 0.97
PF01594AI-2E_transport 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 1.94
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.97
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.97
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.97
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.97
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.97
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.97
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.97
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.97
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.97
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.97
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.97
COG4403Lantibiotic modifying enzymeDefense mechanisms [V] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.50 %
UnclassifiedrootN/A16.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908009|FWIRA_GRAM18402IDYICAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
2189573001|GZR05M101BSUXYNot Available521Open in IMG/M
3300000956|JGI10216J12902_107287794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300000956|JGI10216J12902_114826759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300002568|C688J35102_120313128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales984Open in IMG/M
3300004063|Ga0055483_10146191Not Available752Open in IMG/M
3300004156|Ga0062589_101498895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300004463|Ga0063356_100691135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1400Open in IMG/M
3300004479|Ga0062595_100399817All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300004479|Ga0062595_101138950All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300004480|Ga0062592_100230690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1337Open in IMG/M
3300004799|Ga0058863_10020101All Organisms → cellular organisms → Bacteria → Terrabacteria group565Open in IMG/M
3300005093|Ga0062594_101906557All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005167|Ga0066672_10839611All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005328|Ga0070676_11336298All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005329|Ga0070683_101754941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300005332|Ga0066388_102913969All Organisms → cellular organisms → Bacteria → Proteobacteria874Open in IMG/M
3300005332|Ga0066388_107309041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300005344|Ga0070661_100674581All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005344|Ga0070661_100921132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300005434|Ga0070709_11786019Not Available503Open in IMG/M
3300005439|Ga0070711_101361868All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005467|Ga0070706_101153557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia713Open in IMG/M
3300005526|Ga0073909_10655151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales523Open in IMG/M
3300005540|Ga0066697_10669862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter570Open in IMG/M
3300005540|Ga0066697_10743576All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005547|Ga0070693_100236186All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300005553|Ga0066695_10081616All Organisms → cellular organisms → Bacteria1965Open in IMG/M
3300005556|Ga0066707_10097685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1799Open in IMG/M
3300005568|Ga0066703_10813288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300005569|Ga0066705_10760904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300005576|Ga0066708_10540617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces thermocarboxydus751Open in IMG/M
3300005578|Ga0068854_101929875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300005614|Ga0068856_100303253All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300005718|Ga0068866_10945366All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005764|Ga0066903_101477060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1282Open in IMG/M
3300006028|Ga0070717_10742899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300006046|Ga0066652_100728555All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300006175|Ga0070712_101020524All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300006800|Ga0066660_10183673All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300006954|Ga0079219_12231410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300009098|Ga0105245_12338071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300009840|Ga0126313_10447690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M
3300010140|Ga0127456_1207747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium631Open in IMG/M
3300010337|Ga0134062_10717000All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010361|Ga0126378_10459684All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300010373|Ga0134128_12074561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300010375|Ga0105239_10067088All Organisms → cellular organisms → Bacteria3941Open in IMG/M
3300010375|Ga0105239_13371177Not Available520Open in IMG/M
3300010398|Ga0126383_12188598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300010401|Ga0134121_13257346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Tremellomycetes → Tremellales → Trimorphomycetaceae → Saitozyma → Saitozyma podzolica502Open in IMG/M
3300010999|Ga0138505_100037237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium679Open in IMG/M
3300012208|Ga0137376_10305046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1382Open in IMG/M
3300012505|Ga0157339_1042112Not Available576Open in IMG/M
3300012895|Ga0157309_10181682Not Available646Open in IMG/M
3300012897|Ga0157285_10020207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1410Open in IMG/M
3300012908|Ga0157286_10067096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium970Open in IMG/M
3300012957|Ga0164303_11207517All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300012958|Ga0164299_10142104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1316Open in IMG/M
3300012976|Ga0134076_10377856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300012987|Ga0164307_11697280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012989|Ga0164305_12135135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300013102|Ga0157371_10314384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1136Open in IMG/M
3300013296|Ga0157374_11779554Not Available641Open in IMG/M
3300014325|Ga0163163_10176426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2184Open in IMG/M
3300014969|Ga0157376_11391878Not Available733Open in IMG/M
3300015051|Ga0137414_1151695Not Available6430Open in IMG/M
3300015356|Ga0134073_10249774All Organisms → cellular organisms → Bacteria → Terrabacteria group612Open in IMG/M
3300015373|Ga0132257_103287087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300017792|Ga0163161_12076060Not Available505Open in IMG/M
3300017966|Ga0187776_11348110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300018431|Ga0066655_11341142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta516Open in IMG/M
3300019362|Ga0173479_10663920Not Available556Open in IMG/M
3300023077|Ga0247802_1075806Not Available562Open in IMG/M
3300023077|Ga0247802_1080207Not Available550Open in IMG/M
3300025910|Ga0207684_11188123Not Available632Open in IMG/M
3300025910|Ga0207684_11239997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300025917|Ga0207660_11021358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300025928|Ga0207700_10878124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium802Open in IMG/M
3300025981|Ga0207640_10326479All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300026023|Ga0207677_10707379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria894Open in IMG/M
3300026067|Ga0207678_11876195All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300026523|Ga0209808_1283244Not Available531Open in IMG/M
3300026524|Ga0209690_1082464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1351Open in IMG/M
3300026542|Ga0209805_1178513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300027775|Ga0209177_10492022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300028589|Ga0247818_11242389Not Available533Open in IMG/M
3300028714|Ga0307309_10167851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300028800|Ga0265338_10046427All Organisms → cellular organisms → Bacteria3980Open in IMG/M
3300028800|Ga0265338_10487744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300028814|Ga0307302_10170994All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300028824|Ga0307310_10566108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300028881|Ga0307277_10134727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1065Open in IMG/M
3300028884|Ga0307308_10605624All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031247|Ga0265340_10457795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300031455|Ga0307505_10592285All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300031544|Ga0318534_10518171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300031938|Ga0308175_102397074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300032002|Ga0307416_102506223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300032005|Ga0307411_10104895All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300032180|Ga0307471_103714714Not Available540Open in IMG/M
3300032829|Ga0335070_11774021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300034149|Ga0364929_0348546All Organisms → cellular organisms → Bacteria513Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.97%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.97%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.97%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRA_029052202124908009SoilRSAGFVCGYRDTQAIDSPLEDFMAAGQREVLVRPADLEAARALLEESKS
FD2_016963002189573001Grass SoilIECGHRDTEAIDSPLEDFMSAGGREILVRESDLEAAKELLAAPEA
JGI10216J12902_10728779423300000956SoilCGLLQANGIDCAYRDTAAIDSPLEDFIEAGAREILVRPGDLEAARSLLPDAG*
JGI10216J12902_11482675913300000956SoilRDTEAIDSSLEEFTAAGPREILVHPSDLDAARELLVDSTNE*
C688J35102_12031312833300002568SoilETQAVDSLLEEFTPSGPQEVLVHPSDLDAARELLAQSDR*
Ga0055483_1014619123300004063Natural And Restored WetlandsIECGYRDTEALDSPLEDFTASGQREILVHGSDLDGARAVLAQPES*
Ga0062589_10149889523300004156SoilAYRDTEAIDSPLEDFTAAGAREILVRPADLEAARALLPDPS*
Ga0063356_10069113513300004463Arabidopsis Thaliana RhizosphereAGIECGYRETEAVDSLLEEFTPSGPQEILVHPSDLDAARELLAPPTG*
Ga0062595_10039981723300004479SoilIECAYRDTEAIDSTIEDFIASGPREIVVRASDLDAARELLAAPGDGD*
Ga0062595_10113895033300004479SoilYRDTEAIDSPIEDFIEAGPREILVQPADLDAARALLDDPAA*
Ga0062592_10023069013300004480SoilVCGLLRSAGIECCYRHTEAIDSQLEDFTSAAGSQEILVHEKDLETARELVADQS*
Ga0058863_1002010123300004799Host-AssociatedAGIKCGYRDTEAIDSPLEDFMAAGAQEILVHESDLEAAKELLPQQ*
Ga0062594_10190655713300005093SoilGLLRSQGIACGYRDTEAIDSPLEDFTAAGAREILVRDADLEAARALLDAPTA*
Ga0066672_1083961123300005167SoilLRSAGIDSFYRDTEEIDSPLEDFTAAGPREIVVRSTDADAARQLLAESTH*
Ga0070676_1133629823300005328Miscanthus RhizosphereLCGLLRSQGIACGYRDTEAIDSPLEDFTAAGAREILVRDADLEAARALLDAPTA*
Ga0070683_10175494123300005329Corn RhizosphereLLRSAGIECGYRETEAIDSSLEEFIASGPREILVHPDDLERARAVLPASNA*
Ga0066388_10291396923300005332Tropical Forest SoilGIDCAYRDTEAIDSPLEDFIEAGAREILVRPADLEAARSLLPDES*
Ga0066388_10730904123300005332Tropical Forest SoilIDCAYRDTEAIDSSLEEFTAAGPREILVHPSDLDAARELLVDSTDE*
Ga0070661_10067458133300005344Corn RhizosphereCGLLRSAGIDCAYRDTEAIDSPIEDFIEAGPREILVQPADLDAARALLDDPAA*
Ga0070661_10092113213300005344Corn RhizosphereGYRDTEAIDSPLEDFAASGPREILVQESDLDDARALLDSAPG*
Ga0070709_1178601923300005434Corn, Switchgrass And Miscanthus RhizosphereIECGYRDTAPIDSTVEDFIAAGPREILVHPDDLERARALLPAS*
Ga0070711_10136186813300005439Corn, Switchgrass And Miscanthus RhizosphereGIDCAYRDTEAIESSLEEFIAAGPREMLVPAADLDAARELLAGSTG*
Ga0070706_10115355713300005467Corn, Switchgrass And Miscanthus RhizosphereDCAYRDTEAIDSSLEEFTAAGPREILVHASDLEAARELLAASTT*
Ga0073909_1065515113300005526Surface SoilLRSAGLECGYRDTQSIDSPIEDFIAAGPREILVKESDLEVARELLGPSAG*
Ga0066697_1066986223300005540SoilAGIDCFYRDTEAIDSPLEDFTAAGQREIVVRSSDADAARQLLP*
Ga0066697_1074357623300005540SoilYRDTEAIDSPIEDFIEAGPVEVVVPASDLQAARELLAASKD*
Ga0070693_10023618613300005547Corn, Switchgrass And Miscanthus RhizosphereLRSAGIDCAYRDTEAIDSPIEDFIEAGPREILVQLADLDAARALLDDPAA*
Ga0066695_1008161643300005553SoilVCGLLRSNGIECGYRDTEAIDSPLEDFTAAGQREILVRAADADAARALLEAD*
Ga0066707_1009768543300005556SoilAGIACGYRDTEAIDSPLEDFIAAGPREILVPESDLQAARALLADSVR*
Ga0066703_1081328833300005568SoilCAYRETEAIESSLEDFTAAGPREILVHESDLAAGRELIAPSST*
Ga0066705_1076090423300005569SoilAEVLCGLLQANGIDCGYRDTEAIDSPLEDFTAAGAREVLVRPSDLEAARSLLPDPD*
Ga0066708_1054061713300005576SoilIECGYRDTEAIDSPLEDFTAAGQREILVRAADADAARALLEAD*
Ga0068854_10192987513300005578Corn RhizosphereIACGYRDTEAIDSPLEDFAASGPREILVQESDLDDARALLDSAPG*
Ga0068856_10030325333300005614Corn RhizosphereSAGIECFYRETEEIDSPLEDFIAAGQREIVVREADADAARELLTAPT*
Ga0068866_1094536613300005718Miscanthus RhizosphereGIECGYRDTDAVDSRFEEFIASGPREILVHQSDLEAARALLGEADS*
Ga0066903_10147706013300005764Tropical Forest SoilYRDTEAIDSSLEEFTAAGPREILVHASDLDAARELLVDSTNE*
Ga0070717_1074289923300006028Corn, Switchgrass And Miscanthus RhizosphereLLRDGGIECGYRDTAPIDSAVEDFIAAGPREILVHPDDLERARALLPTP*
Ga0066652_10072855513300006046SoilCAYRDTEAIESALEEFTAAGPREILVRASDLDAARELLAGSAT*
Ga0070712_10102052433300006175Corn, Switchgrass And Miscanthus RhizosphereGLECGYRDTDALDSQLEDFIAAGAREILVHASEIDDARAVLAAAEG*
Ga0066660_1018367333300006800SoilVSRKPTSSAAYYRSAGIDCAYRDTEAIDSSLEDFTAAGPREILVRASDLDAARELLAAPSA*
Ga0079219_1223141023300006954Agricultural SoilYRDTEAIDSPIEDFIASGPREILVSPDDLEDARQLLKDSEQS*
Ga0105245_1233807113300009098Miscanthus RhizosphereLLRSAGFVCGYRDTQAIDSPLEDFMAAGQREVLVRPADLEAARALLEESKS*
Ga0126313_1044769023300009840Serpentine SoilLRSAGIECGYRETDAIDSTLEDFTPAGPREIYVQPANLEVARELLSSE*
Ga0127456_120774723300010140Grasslands SoilVCGLLRSAGFECAYRDTEAIDSQLEDFIAAGSREVLVHAADLEAAKELLAAPAAED*
Ga0134062_1071700023300010337Grasslands SoilRSNGIDCAYRETEAIESSLEDFTAAGPREILVHESDLAAGRELIAPSST*
Ga0126378_1045968433300010361Tropical Forest SoilCGLLRSAGIECGHRDTDAIDSPLEDFMAAGAQEILVRESDLEAAQELLAAPEV*
Ga0134128_1207456123300010373Terrestrial SoilLESAGIECAYRDTDAIESSLEEFTASGPREILVHPTDLDAAKQLVGNATAG*
Ga0105239_1006708863300010375Corn RhizosphereLRSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMAKALLEESSPGTG*
Ga0105239_1337117723300010375Corn RhizosphereGLLRSAGFECGYRDTEAIDSPLEDFTAAGQREILVHAPDLEAARALLEDAERSAT*
Ga0126383_1218859813300010398Tropical Forest SoilILCGLLQANGIECAYRDTEAIDSPLEDFTAAGAREILVRPADLEAARALLPGSA*
Ga0134121_1325734623300010401Terrestrial SoilGIECGYRDTEAIDSQLEDFTAAGPREILVHAPDLEAARALLDEAE*
Ga0138505_10003723713300010999SoilLRSAGIECAYRDTQAIDSPLEDFIASGPREILVREADAQAARALLDASPG*
Ga0137376_1030504613300012208Vadose Zone SoilIDCAYRDTEAIDSPLEEFTAAGPREILVRASDLNAARELLADSRPDAGEGVN*
Ga0157339_104211213300012505Arabidopsis RhizosphereGIECAYRDTEAIDSPIEDFIASGPREIVVRASDLEAARELLRADG*
Ga0157309_1018168213300012895SoilHRETDAIDSPVEDFIPGGPREVMVYERDLEAARTLLPEP*
Ga0157285_1002020733300012897SoilNGIECGYRDTDAIDSPLEDFMTSGPREILVHEADLETARALLPA*
Ga0157286_1006709633300012908SoilAYRDTEAIDSPIEDFIAAGPREVLVHEVDLEAARALLPDS*
Ga0164303_1120751713300012957SoilLRSEGIECAYRDTEKIDSSLEDFIAAGSREILVYEKDLAAAKELLAAT*
Ga0164299_1014210413300012958SoilRSAGIECAHRDTDAIDSPLEDFIAAGAQEILVHASDLEAAKELLEAT*
Ga0134076_1037785613300012976Grasslands SoilGIECGYRDTEAIDSTIEDFIAAGAREILVREADLETARELLAPVE*
Ga0164307_1169728013300012987SoilYRDTPAIDSPLEDFMTAGPREILVRPADLQAARALLEDSAQ*
Ga0164305_1213513523300012989SoilSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMAKALLEESSPDTG*
Ga0157371_1031438413300013102Corn RhizosphereNGIECAYRDTEAIDSPMEDFIAAGPREVLVHEVDLEAARALLPDS*
Ga0157374_1177955423300013296Miscanthus RhizosphereLRSSGIECGYRDTSAIDSPLEDFMAAGQREILVHAADLEAARALVDDAVS*
Ga0163163_1017642653300014325Switchgrass RhizosphereRDTEAIDLSLEEFTAAGPREILVHSSDLEAARELLAADSSVDN*
Ga0157376_1139187813300014969Miscanthus RhizosphereRDTDVIDDPYEDFAASGPREIVVHAADADAARELLADTGD*
Ga0137414_115169583300015051Vadose Zone SoilLRFRDTEAIDSPLEDFTAAGPREILVQETDMDAARALLDDSAD*
Ga0134073_1024977423300015356Grasslands SoilLRSAGIECAHRDTDAIDSPLEDFMAAGSQEVLVHDSDLESAKELLPEQ*
Ga0132257_10328708713300015373Arabidopsis RhizosphereRSAGIECAYRDTQAIDSPLEDFTAAGPREIVVRAADLEAAKALLPRSPR*
Ga0163161_1207606013300017792Switchgrass RhizosphereGIECAYRDTDAIDSPIEEFIASGPREVLVHEKDLEAARTLLPES
Ga0187776_1134811013300017966Tropical PeatlandRSAGLECGYRDTEALDSPLEQLTAAGPREILVHEPDLAAARALVEAQT
Ga0066655_1134114213300018431Grasslands SoilDGIDCTYRETEAIESPLEDFTAAGPREILVPEADVEAARALLPGSAS
Ga0173479_1066392023300019362SoilGIECAYRDTEAIDSPMEDFIAAGPREVLVHEVDLEAARALLPDS
Ga0247802_107580613300023077SoilANGIECAYRDTEAIDSPMEDFIAAGPREVLVHEVDLEAARALLPDS
Ga0247802_108020733300023077SoilIECGYRDTDAIDSPLEDFMTSGPREILVHEADLETARALLPA
Ga0207684_1118812323300025910Corn, Switchgrass And Miscanthus RhizosphereDCAYRDTEAIDSSLEEFTAAGPREILVHASDLEAARELLAASTT
Ga0207684_1123999723300025910Corn, Switchgrass And Miscanthus RhizosphereSAGIDCAYRDTEAIESPIEDFIAAGPREILVRESDVDAARALLAESAS
Ga0207660_1102135823300025917Corn RhizosphereCGLLRSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMARALLEESSDTG
Ga0207700_1087812413300025928Corn, Switchgrass And Miscanthus RhizosphereASEAEVVCGLLRSAGIECAYRETEAIDSPLEDFIAAGSQEILVHEVELEAAKELLAAQQS
Ga0207640_1032647913300025981Corn RhizosphereIACGYRDTEAIDSPLEDFAASGPREILVQESDLDDARALLDSAPG
Ga0207677_1070737933300026023Miscanthus RhizosphereLRSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMARALLEESSDTG
Ga0207678_1187619523300026067Corn RhizosphereCAYRDTSAIDSSLEEFTAAGPREILVAPADLDAAHALLEDAKS
Ga0209808_128324423300026523SoilIECGYRDTEAIDSPLEDFTAAGQREILVRAADADAARALLEAD
Ga0209690_108246413300026524SoilAGIDCAYRDTEAIESSLEDFTAAGPREILVRASDLDAAKELLADSS
Ga0209805_117851333300026542SoilDCAYRDTEAIDSPLEDFTAAGPREILVREPDLQAARALLADAAR
Ga0209177_1049202213300027775Agricultural SoilYRDTEAIDSPIEDFIASGPREILVSPDDLEDARQLLKDSEQS
Ga0247818_1124238913300028589SoilRANGIECGYRDTDAIDSPLEDFMTSGPREILVHEADLETARALLPA
Ga0307309_1016785113300028714SoilAGIECAYRDTQAIDSPIEDFIAAGPREILVREADVEAAQALLEASPG
Ga0265338_1004642763300028800RhizosphereLRNAGIACGYRDTEATDSPLEDFIASGPREILVHSDDLEAARSVLTAREA
Ga0265338_1048774413300028800RhizosphereGLLRANGIDCSYRETDEIDSPLEEFTAAGFREILVRPTDLEAARALLPDASD
Ga0307302_1017099413300028814SoilGLLRSAGIECGYRETDAIDSTLEDFSADGPREIHVHPSDLEVARALLGDAES
Ga0307310_1056610813300028824SoilGYRDTDAIDSPLEDFQSAGQREILVRPADVEMAKALLEESSPNAG
Ga0307277_1013472713300028881SoilECGYRDTEAIESSLEEFTAAGPREILVRAADVEAARELLAASTS
Ga0307308_1060562413300028884SoilDCAYRDTEVIDSPLEDFIASGPREILVRDSDLEAAKELLADSAG
Ga0265340_1045779513300031247RhizosphereRANGIDCAYRDTEEIDSPLEGFTEAGLREILVKPADLESARALLPAD
Ga0307505_1059228523300031455SoilRSNGIECGYRDTEQIESSLEDFTASGPREIFVRPSDLEAAQALLGEGQG
Ga0318534_1051817123300031544SoilIKCGHRDTEAIDSQLEDFIAAGPREILVHPDDLEDAKSVLAARDA
Ga0308175_10239707423300031938SoilRSAGIDCAYRDTEAIDSPLEDFIAAGPREILVQPGDVDAARALLDDSAA
Ga0307416_10250622323300032002RhizosphereLRSAGIECAYRDTDAIDSPLEDFTAAGPREIVVRAADLEAAKALLARSTG
Ga0307411_1010489513300032005RhizosphereGIECGYRDTDATDSALEDFMTSGPREILVHEADLETARALLPES
Ga0307471_10371471413300032180Hardwood Forest SoilLRSAGIECGYRDTEAIDSQLEDFTAAGPREILVHAKDLETARALLVEEAL
Ga0335070_1177402113300032829SoilGIRCAYRDTAAIDSPLEDFTAAGPREILVHTDDLDAARELLGVAG
Ga0364929_0348546_3_1433300034149SedimentGIECGYRETDAIDSTLEDFSADGPREIHVHPSDLEDARALLGEAEG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.