| Basic Information | |
|---|---|
| Family ID | F099638 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GIECGYRDTEAIDSQLEDFTAAGPREILVHAPDLEAARALLDEAE |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.06 % |
| % of genes from short scaffolds (< 2000 bps) | 95.15 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.524 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.369 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 13.70% Coil/Unstructured: 60.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF09413 | DUF2007 | 7.77 |
| PF00903 | Glyoxalase | 7.77 |
| PF09723 | Zn-ribbon_8 | 6.80 |
| PF07883 | Cupin_2 | 2.91 |
| PF13231 | PMT_2 | 1.94 |
| PF07690 | MFS_1 | 1.94 |
| PF00035 | dsrm | 1.94 |
| PF03575 | Peptidase_S51 | 1.94 |
| PF05496 | RuvB_N | 1.94 |
| PF14079 | DUF4260 | 1.94 |
| PF00196 | GerE | 1.94 |
| PF03706 | LPG_synthase_TM | 0.97 |
| PF13185 | GAF_2 | 0.97 |
| PF07676 | PD40 | 0.97 |
| PF01022 | HTH_5 | 0.97 |
| PF13424 | TPR_12 | 0.97 |
| PF01872 | RibD_C | 0.97 |
| PF01625 | PMSR | 0.97 |
| PF02518 | HATPase_c | 0.97 |
| PF13340 | DUF4096 | 0.97 |
| PF08240 | ADH_N | 0.97 |
| PF00254 | FKBP_C | 0.97 |
| PF03413 | PepSY | 0.97 |
| PF00291 | PALP | 0.97 |
| PF00132 | Hexapep | 0.97 |
| PF08447 | PAS_3 | 0.97 |
| PF01545 | Cation_efflux | 0.97 |
| PF13365 | Trypsin_2 | 0.97 |
| PF00909 | Ammonium_transp | 0.97 |
| PF00106 | adh_short | 0.97 |
| PF03795 | YCII | 0.97 |
| PF13489 | Methyltransf_23 | 0.97 |
| PF00583 | Acetyltransf_1 | 0.97 |
| PF01569 | PAP2 | 0.97 |
| PF00440 | TetR_N | 0.97 |
| PF00892 | EamA | 0.97 |
| PF01636 | APH | 0.97 |
| PF13673 | Acetyltransf_10 | 0.97 |
| PF00027 | cNMP_binding | 0.97 |
| PF02628 | COX15-CtaA | 0.97 |
| PF08327 | AHSA1 | 0.97 |
| PF05147 | LANC_like | 0.97 |
| PF13377 | Peripla_BP_3 | 0.97 |
| PF03992 | ABM | 0.97 |
| PF12464 | Mac | 0.97 |
| PF01594 | AI-2E_transport | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 1.94 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.97 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.97 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.97 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.97 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.97 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.97 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.50 % |
| Unclassified | root | N/A | 16.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18402IDYIC | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 2189573001|GZR05M101BSUXY | Not Available | 521 | Open in IMG/M |
| 3300000956|JGI10216J12902_107287794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300000956|JGI10216J12902_114826759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300002568|C688J35102_120313128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 984 | Open in IMG/M |
| 3300004063|Ga0055483_10146191 | Not Available | 752 | Open in IMG/M |
| 3300004156|Ga0062589_101498895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300004463|Ga0063356_100691135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1400 | Open in IMG/M |
| 3300004479|Ga0062595_100399817 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300004479|Ga0062595_101138950 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300004480|Ga0062592_100230690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1337 | Open in IMG/M |
| 3300004799|Ga0058863_10020101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
| 3300005093|Ga0062594_101906557 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005167|Ga0066672_10839611 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005328|Ga0070676_11336298 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005329|Ga0070683_101754941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300005332|Ga0066388_102913969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300005332|Ga0066388_107309041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300005344|Ga0070661_100674581 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005344|Ga0070661_100921132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300005434|Ga0070709_11786019 | Not Available | 503 | Open in IMG/M |
| 3300005439|Ga0070711_101361868 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005467|Ga0070706_101153557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 713 | Open in IMG/M |
| 3300005526|Ga0073909_10655151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 523 | Open in IMG/M |
| 3300005540|Ga0066697_10669862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 570 | Open in IMG/M |
| 3300005540|Ga0066697_10743576 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005547|Ga0070693_100236186 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005553|Ga0066695_10081616 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300005556|Ga0066707_10097685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1799 | Open in IMG/M |
| 3300005568|Ga0066703_10813288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300005569|Ga0066705_10760904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300005576|Ga0066708_10540617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces thermocarboxydus | 751 | Open in IMG/M |
| 3300005578|Ga0068854_101929875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300005614|Ga0068856_100303253 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300005718|Ga0068866_10945366 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005764|Ga0066903_101477060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
| 3300006028|Ga0070717_10742899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300006046|Ga0066652_100728555 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300006175|Ga0070712_101020524 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006800|Ga0066660_10183673 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300006954|Ga0079219_12231410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300009098|Ga0105245_12338071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300009840|Ga0126313_10447690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300010140|Ga0127456_1207747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300010337|Ga0134062_10717000 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010361|Ga0126378_10459684 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300010373|Ga0134128_12074561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300010375|Ga0105239_10067088 | All Organisms → cellular organisms → Bacteria | 3941 | Open in IMG/M |
| 3300010375|Ga0105239_13371177 | Not Available | 520 | Open in IMG/M |
| 3300010398|Ga0126383_12188598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300010401|Ga0134121_13257346 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Tremellomycetes → Tremellales → Trimorphomycetaceae → Saitozyma → Saitozyma podzolica | 502 | Open in IMG/M |
| 3300010999|Ga0138505_100037237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
| 3300012208|Ga0137376_10305046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
| 3300012505|Ga0157339_1042112 | Not Available | 576 | Open in IMG/M |
| 3300012895|Ga0157309_10181682 | Not Available | 646 | Open in IMG/M |
| 3300012897|Ga0157285_10020207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1410 | Open in IMG/M |
| 3300012908|Ga0157286_10067096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300012957|Ga0164303_11207517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300012958|Ga0164299_10142104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1316 | Open in IMG/M |
| 3300012976|Ga0134076_10377856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300012987|Ga0164307_11697280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300012989|Ga0164305_12135135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300013102|Ga0157371_10314384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1136 | Open in IMG/M |
| 3300013296|Ga0157374_11779554 | Not Available | 641 | Open in IMG/M |
| 3300014325|Ga0163163_10176426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2184 | Open in IMG/M |
| 3300014969|Ga0157376_11391878 | Not Available | 733 | Open in IMG/M |
| 3300015051|Ga0137414_1151695 | Not Available | 6430 | Open in IMG/M |
| 3300015356|Ga0134073_10249774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 612 | Open in IMG/M |
| 3300015373|Ga0132257_103287087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300017792|Ga0163161_12076060 | Not Available | 505 | Open in IMG/M |
| 3300017966|Ga0187776_11348110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300018431|Ga0066655_11341142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 516 | Open in IMG/M |
| 3300019362|Ga0173479_10663920 | Not Available | 556 | Open in IMG/M |
| 3300023077|Ga0247802_1075806 | Not Available | 562 | Open in IMG/M |
| 3300023077|Ga0247802_1080207 | Not Available | 550 | Open in IMG/M |
| 3300025910|Ga0207684_11188123 | Not Available | 632 | Open in IMG/M |
| 3300025910|Ga0207684_11239997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300025917|Ga0207660_11021358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300025928|Ga0207700_10878124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 802 | Open in IMG/M |
| 3300025981|Ga0207640_10326479 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300026023|Ga0207677_10707379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300026067|Ga0207678_11876195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300026523|Ga0209808_1283244 | Not Available | 531 | Open in IMG/M |
| 3300026524|Ga0209690_1082464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1351 | Open in IMG/M |
| 3300026542|Ga0209805_1178513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300027775|Ga0209177_10492022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300028589|Ga0247818_11242389 | Not Available | 533 | Open in IMG/M |
| 3300028714|Ga0307309_10167851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300028800|Ga0265338_10046427 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
| 3300028800|Ga0265338_10487744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300028814|Ga0307302_10170994 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300028824|Ga0307310_10566108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300028881|Ga0307277_10134727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1065 | Open in IMG/M |
| 3300028884|Ga0307308_10605624 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031247|Ga0265340_10457795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300031455|Ga0307505_10592285 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031544|Ga0318534_10518171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300031938|Ga0308175_102397074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300032002|Ga0307416_102506223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300032005|Ga0307411_10104895 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300032180|Ga0307471_103714714 | Not Available | 540 | Open in IMG/M |
| 3300032829|Ga0335070_11774021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300034149|Ga0364929_0348546 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.97% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_02905220 | 2124908009 | Soil | RSAGFVCGYRDTQAIDSPLEDFMAAGQREVLVRPADLEAARALLEESKS |
| FD2_01696300 | 2189573001 | Grass Soil | IECGHRDTEAIDSPLEDFMSAGGREILVRESDLEAAKELLAAPEA |
| JGI10216J12902_1072877942 | 3300000956 | Soil | CGLLQANGIDCAYRDTAAIDSPLEDFIEAGAREILVRPGDLEAARSLLPDAG* |
| JGI10216J12902_1148267591 | 3300000956 | Soil | RDTEAIDSSLEEFTAAGPREILVHPSDLDAARELLVDSTNE* |
| C688J35102_1203131283 | 3300002568 | Soil | ETQAVDSLLEEFTPSGPQEVLVHPSDLDAARELLAQSDR* |
| Ga0055483_101461912 | 3300004063 | Natural And Restored Wetlands | IECGYRDTEALDSPLEDFTASGQREILVHGSDLDGARAVLAQPES* |
| Ga0062589_1014988952 | 3300004156 | Soil | AYRDTEAIDSPLEDFTAAGAREILVRPADLEAARALLPDPS* |
| Ga0063356_1006911351 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AGIECGYRETEAVDSLLEEFTPSGPQEILVHPSDLDAARELLAPPTG* |
| Ga0062595_1003998172 | 3300004479 | Soil | IECAYRDTEAIDSTIEDFIASGPREIVVRASDLDAARELLAAPGDGD* |
| Ga0062595_1011389503 | 3300004479 | Soil | YRDTEAIDSPIEDFIEAGPREILVQPADLDAARALLDDPAA* |
| Ga0062592_1002306901 | 3300004480 | Soil | VCGLLRSAGIECCYRHTEAIDSQLEDFTSAAGSQEILVHEKDLETARELVADQS* |
| Ga0058863_100201012 | 3300004799 | Host-Associated | AGIKCGYRDTEAIDSPLEDFMAAGAQEILVHESDLEAAKELLPQQ* |
| Ga0062594_1019065571 | 3300005093 | Soil | GLLRSQGIACGYRDTEAIDSPLEDFTAAGAREILVRDADLEAARALLDAPTA* |
| Ga0066672_108396112 | 3300005167 | Soil | LRSAGIDSFYRDTEEIDSPLEDFTAAGPREIVVRSTDADAARQLLAESTH* |
| Ga0070676_113362982 | 3300005328 | Miscanthus Rhizosphere | LCGLLRSQGIACGYRDTEAIDSPLEDFTAAGAREILVRDADLEAARALLDAPTA* |
| Ga0070683_1017549412 | 3300005329 | Corn Rhizosphere | LLRSAGIECGYRETEAIDSSLEEFIASGPREILVHPDDLERARAVLPASNA* |
| Ga0066388_1029139692 | 3300005332 | Tropical Forest Soil | GIDCAYRDTEAIDSPLEDFIEAGAREILVRPADLEAARSLLPDES* |
| Ga0066388_1073090412 | 3300005332 | Tropical Forest Soil | IDCAYRDTEAIDSSLEEFTAAGPREILVHPSDLDAARELLVDSTDE* |
| Ga0070661_1006745813 | 3300005344 | Corn Rhizosphere | CGLLRSAGIDCAYRDTEAIDSPIEDFIEAGPREILVQPADLDAARALLDDPAA* |
| Ga0070661_1009211321 | 3300005344 | Corn Rhizosphere | GYRDTEAIDSPLEDFAASGPREILVQESDLDDARALLDSAPG* |
| Ga0070709_117860192 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IECGYRDTAPIDSTVEDFIAAGPREILVHPDDLERARALLPAS* |
| Ga0070711_1013618681 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GIDCAYRDTEAIESSLEEFIAAGPREMLVPAADLDAARELLAGSTG* |
| Ga0070706_1011535571 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DCAYRDTEAIDSSLEEFTAAGPREILVHASDLEAARELLAASTT* |
| Ga0073909_106551511 | 3300005526 | Surface Soil | LRSAGLECGYRDTQSIDSPIEDFIAAGPREILVKESDLEVARELLGPSAG* |
| Ga0066697_106698622 | 3300005540 | Soil | AGIDCFYRDTEAIDSPLEDFTAAGQREIVVRSSDADAARQLLP* |
| Ga0066697_107435762 | 3300005540 | Soil | YRDTEAIDSPIEDFIEAGPVEVVVPASDLQAARELLAASKD* |
| Ga0070693_1002361861 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSAGIDCAYRDTEAIDSPIEDFIEAGPREILVQLADLDAARALLDDPAA* |
| Ga0066695_100816164 | 3300005553 | Soil | VCGLLRSNGIECGYRDTEAIDSPLEDFTAAGQREILVRAADADAARALLEAD* |
| Ga0066707_100976854 | 3300005556 | Soil | AGIACGYRDTEAIDSPLEDFIAAGPREILVPESDLQAARALLADSVR* |
| Ga0066703_108132883 | 3300005568 | Soil | CAYRETEAIESSLEDFTAAGPREILVHESDLAAGRELIAPSST* |
| Ga0066705_107609042 | 3300005569 | Soil | AEVLCGLLQANGIDCGYRDTEAIDSPLEDFTAAGAREVLVRPSDLEAARSLLPDPD* |
| Ga0066708_105406171 | 3300005576 | Soil | IECGYRDTEAIDSPLEDFTAAGQREILVRAADADAARALLEAD* |
| Ga0068854_1019298751 | 3300005578 | Corn Rhizosphere | IACGYRDTEAIDSPLEDFAASGPREILVQESDLDDARALLDSAPG* |
| Ga0068856_1003032533 | 3300005614 | Corn Rhizosphere | SAGIECFYRETEEIDSPLEDFIAAGQREIVVREADADAARELLTAPT* |
| Ga0068866_109453661 | 3300005718 | Miscanthus Rhizosphere | GIECGYRDTDAVDSRFEEFIASGPREILVHQSDLEAARALLGEADS* |
| Ga0066903_1014770601 | 3300005764 | Tropical Forest Soil | YRDTEAIDSSLEEFTAAGPREILVHASDLDAARELLVDSTNE* |
| Ga0070717_107428992 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRDGGIECGYRDTAPIDSAVEDFIAAGPREILVHPDDLERARALLPTP* |
| Ga0066652_1007285551 | 3300006046 | Soil | CAYRDTEAIESALEEFTAAGPREILVRASDLDAARELLAGSAT* |
| Ga0070712_1010205243 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLECGYRDTDALDSQLEDFIAAGAREILVHASEIDDARAVLAAAEG* |
| Ga0066660_101836733 | 3300006800 | Soil | VSRKPTSSAAYYRSAGIDCAYRDTEAIDSSLEDFTAAGPREILVRASDLDAARELLAAPSA* |
| Ga0079219_122314102 | 3300006954 | Agricultural Soil | YRDTEAIDSPIEDFIASGPREILVSPDDLEDARQLLKDSEQS* |
| Ga0105245_123380711 | 3300009098 | Miscanthus Rhizosphere | LLRSAGFVCGYRDTQAIDSPLEDFMAAGQREVLVRPADLEAARALLEESKS* |
| Ga0126313_104476902 | 3300009840 | Serpentine Soil | LRSAGIECGYRETDAIDSTLEDFTPAGPREIYVQPANLEVARELLSSE* |
| Ga0127456_12077472 | 3300010140 | Grasslands Soil | VCGLLRSAGFECAYRDTEAIDSQLEDFIAAGSREVLVHAADLEAAKELLAAPAAED* |
| Ga0134062_107170002 | 3300010337 | Grasslands Soil | RSNGIDCAYRETEAIESSLEDFTAAGPREILVHESDLAAGRELIAPSST* |
| Ga0126378_104596843 | 3300010361 | Tropical Forest Soil | CGLLRSAGIECGHRDTDAIDSPLEDFMAAGAQEILVRESDLEAAQELLAAPEV* |
| Ga0134128_120745612 | 3300010373 | Terrestrial Soil | LESAGIECAYRDTDAIESSLEEFTASGPREILVHPTDLDAAKQLVGNATAG* |
| Ga0105239_100670886 | 3300010375 | Corn Rhizosphere | LRSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMAKALLEESSPGTG* |
| Ga0105239_133711772 | 3300010375 | Corn Rhizosphere | GLLRSAGFECGYRDTEAIDSPLEDFTAAGQREILVHAPDLEAARALLEDAERSAT* |
| Ga0126383_121885981 | 3300010398 | Tropical Forest Soil | ILCGLLQANGIECAYRDTEAIDSPLEDFTAAGAREILVRPADLEAARALLPGSA* |
| Ga0134121_132573462 | 3300010401 | Terrestrial Soil | GIECGYRDTEAIDSQLEDFTAAGPREILVHAPDLEAARALLDEAE* |
| Ga0138505_1000372371 | 3300010999 | Soil | LRSAGIECAYRDTQAIDSPLEDFIASGPREILVREADAQAARALLDASPG* |
| Ga0137376_103050461 | 3300012208 | Vadose Zone Soil | IDCAYRDTEAIDSPLEEFTAAGPREILVRASDLNAARELLADSRPDAGEGVN* |
| Ga0157339_10421121 | 3300012505 | Arabidopsis Rhizosphere | GIECAYRDTEAIDSPIEDFIASGPREIVVRASDLEAARELLRADG* |
| Ga0157309_101816821 | 3300012895 | Soil | HRETDAIDSPVEDFIPGGPREVMVYERDLEAARTLLPEP* |
| Ga0157285_100202073 | 3300012897 | Soil | NGIECGYRDTDAIDSPLEDFMTSGPREILVHEADLETARALLPA* |
| Ga0157286_100670963 | 3300012908 | Soil | AYRDTEAIDSPIEDFIAAGPREVLVHEVDLEAARALLPDS* |
| Ga0164303_112075171 | 3300012957 | Soil | LRSEGIECAYRDTEKIDSSLEDFIAAGSREILVYEKDLAAAKELLAAT* |
| Ga0164299_101421041 | 3300012958 | Soil | RSAGIECAHRDTDAIDSPLEDFIAAGAQEILVHASDLEAAKELLEAT* |
| Ga0134076_103778561 | 3300012976 | Grasslands Soil | GIECGYRDTEAIDSTIEDFIAAGAREILVREADLETARELLAPVE* |
| Ga0164307_116972801 | 3300012987 | Soil | YRDTPAIDSPLEDFMTAGPREILVRPADLQAARALLEDSAQ* |
| Ga0164305_121351352 | 3300012989 | Soil | SNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMAKALLEESSPDTG* |
| Ga0157371_103143841 | 3300013102 | Corn Rhizosphere | NGIECAYRDTEAIDSPMEDFIAAGPREVLVHEVDLEAARALLPDS* |
| Ga0157374_117795542 | 3300013296 | Miscanthus Rhizosphere | LRSSGIECGYRDTSAIDSPLEDFMAAGQREILVHAADLEAARALVDDAVS* |
| Ga0163163_101764265 | 3300014325 | Switchgrass Rhizosphere | RDTEAIDLSLEEFTAAGPREILVHSSDLEAARELLAADSSVDN* |
| Ga0157376_113918781 | 3300014969 | Miscanthus Rhizosphere | RDTDVIDDPYEDFAASGPREIVVHAADADAARELLADTGD* |
| Ga0137414_11516958 | 3300015051 | Vadose Zone Soil | LRFRDTEAIDSPLEDFTAAGPREILVQETDMDAARALLDDSAD* |
| Ga0134073_102497742 | 3300015356 | Grasslands Soil | LRSAGIECAHRDTDAIDSPLEDFMAAGSQEVLVHDSDLESAKELLPEQ* |
| Ga0132257_1032870871 | 3300015373 | Arabidopsis Rhizosphere | RSAGIECAYRDTQAIDSPLEDFTAAGPREIVVRAADLEAAKALLPRSPR* |
| Ga0163161_120760601 | 3300017792 | Switchgrass Rhizosphere | GIECAYRDTDAIDSPIEEFIASGPREVLVHEKDLEAARTLLPES |
| Ga0187776_113481101 | 3300017966 | Tropical Peatland | RSAGLECGYRDTEALDSPLEQLTAAGPREILVHEPDLAAARALVEAQT |
| Ga0066655_113411421 | 3300018431 | Grasslands Soil | DGIDCTYRETEAIESPLEDFTAAGPREILVPEADVEAARALLPGSAS |
| Ga0173479_106639202 | 3300019362 | Soil | GIECAYRDTEAIDSPMEDFIAAGPREVLVHEVDLEAARALLPDS |
| Ga0247802_10758061 | 3300023077 | Soil | ANGIECAYRDTEAIDSPMEDFIAAGPREVLVHEVDLEAARALLPDS |
| Ga0247802_10802073 | 3300023077 | Soil | IECGYRDTDAIDSPLEDFMTSGPREILVHEADLETARALLPA |
| Ga0207684_111881232 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DCAYRDTEAIDSSLEEFTAAGPREILVHASDLEAARELLAASTT |
| Ga0207684_112399972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGIDCAYRDTEAIESPIEDFIAAGPREILVRESDVDAARALLAESAS |
| Ga0207660_110213582 | 3300025917 | Corn Rhizosphere | CGLLRSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMARALLEESSDTG |
| Ga0207700_108781241 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ASEAEVVCGLLRSAGIECAYRETEAIDSPLEDFIAAGSQEILVHEVELEAAKELLAAQQS |
| Ga0207640_103264791 | 3300025981 | Corn Rhizosphere | IACGYRDTEAIDSPLEDFAASGPREILVQESDLDDARALLDSAPG |
| Ga0207677_107073793 | 3300026023 | Miscanthus Rhizosphere | LRSNGIDCGYRDTDAIDSPLEDFQSAGQREILVRPADVEMARALLEESSDTG |
| Ga0207678_118761952 | 3300026067 | Corn Rhizosphere | CAYRDTSAIDSSLEEFTAAGPREILVAPADLDAAHALLEDAKS |
| Ga0209808_12832442 | 3300026523 | Soil | IECGYRDTEAIDSPLEDFTAAGQREILVRAADADAARALLEAD |
| Ga0209690_10824641 | 3300026524 | Soil | AGIDCAYRDTEAIESSLEDFTAAGPREILVRASDLDAAKELLADSS |
| Ga0209805_11785133 | 3300026542 | Soil | DCAYRDTEAIDSPLEDFTAAGPREILVREPDLQAARALLADAAR |
| Ga0209177_104920221 | 3300027775 | Agricultural Soil | YRDTEAIDSPIEDFIASGPREILVSPDDLEDARQLLKDSEQS |
| Ga0247818_112423891 | 3300028589 | Soil | RANGIECGYRDTDAIDSPLEDFMTSGPREILVHEADLETARALLPA |
| Ga0307309_101678511 | 3300028714 | Soil | AGIECAYRDTQAIDSPIEDFIAAGPREILVREADVEAAQALLEASPG |
| Ga0265338_100464276 | 3300028800 | Rhizosphere | LRNAGIACGYRDTEATDSPLEDFIASGPREILVHSDDLEAARSVLTAREA |
| Ga0265338_104877441 | 3300028800 | Rhizosphere | GLLRANGIDCSYRETDEIDSPLEEFTAAGFREILVRPTDLEAARALLPDASD |
| Ga0307302_101709941 | 3300028814 | Soil | GLLRSAGIECGYRETDAIDSTLEDFSADGPREIHVHPSDLEVARALLGDAES |
| Ga0307310_105661081 | 3300028824 | Soil | GYRDTDAIDSPLEDFQSAGQREILVRPADVEMAKALLEESSPNAG |
| Ga0307277_101347271 | 3300028881 | Soil | ECGYRDTEAIESSLEEFTAAGPREILVRAADVEAARELLAASTS |
| Ga0307308_106056241 | 3300028884 | Soil | DCAYRDTEVIDSPLEDFIASGPREILVRDSDLEAAKELLADSAG |
| Ga0265340_104577951 | 3300031247 | Rhizosphere | RANGIDCAYRDTEEIDSPLEGFTEAGLREILVKPADLESARALLPAD |
| Ga0307505_105922852 | 3300031455 | Soil | RSNGIECGYRDTEQIESSLEDFTASGPREIFVRPSDLEAAQALLGEGQG |
| Ga0318534_105181712 | 3300031544 | Soil | IKCGHRDTEAIDSQLEDFIAAGPREILVHPDDLEDAKSVLAARDA |
| Ga0308175_1023970742 | 3300031938 | Soil | RSAGIDCAYRDTEAIDSPLEDFIAAGPREILVQPGDVDAARALLDDSAA |
| Ga0307416_1025062232 | 3300032002 | Rhizosphere | LRSAGIECAYRDTDAIDSPLEDFTAAGPREIVVRAADLEAAKALLARSTG |
| Ga0307411_101048951 | 3300032005 | Rhizosphere | GIECGYRDTDATDSALEDFMTSGPREILVHEADLETARALLPES |
| Ga0307471_1037147141 | 3300032180 | Hardwood Forest Soil | LRSAGIECGYRDTEAIDSQLEDFTAAGPREILVHAKDLETARALLVEEAL |
| Ga0335070_117740211 | 3300032829 | Soil | GIRCAYRDTAAIDSPLEDFTAAGPREILVHTDDLDAARELLGVAG |
| Ga0364929_0348546_3_143 | 3300034149 | Sediment | GIECGYRETDAIDSTLEDFSADGPREIHVHPSDLEDARALLGEAEG |
| ⦗Top⦘ |