Metagenome / Metatranscriptome Family F099632

Basic Information
Family ID	F099632
Family Type	Metagenome / Metatranscriptome
Number of Sequences	103
Average Sequence Length	43 residues
Representative Sequence	VSAENWHEERDRLVQLLKAIESGKVTHIDEEDLRQLQAANP
Number of Associated Samples	82
Number of Associated Scaffolds	103

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	94.17 %
% of genes near scaffold ends (potentially truncated)	99.03 %
% of genes from short scaffolds (< 2000 bps)	97.09 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Bacteria (97.087 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (11.650 % of family members)
Environment Ontology (ENVO)	Unclassified (52.427 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (67.961 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 103 Family Scaffolds
PF00313	CSD	6.80
PF12697	Abhydrolase_6	2.91
PF08332	CaMKII_AD	2.91
PF04964	Flp_Fap	1.94
PF00270	DEAD	1.94
PF09722	Xre_MbcA_ParS_C	1.94
PF13581	HATPase_c_2	1.94
PF13545	HTH_Crp_2	0.97
PF07883	Cupin_2	0.97
PF13561	adh_short_C2	0.97
PF13420	Acetyltransf_4	0.97
PF02639	DUF188	0.97
PF07750	GcrA	0.97
PF07589	PEP-CTERM	0.97
PF13602	ADH_zinc_N_2	0.97
PF02518	HATPase_c	0.97

COG ID	Name	Functional Category	% Frequency in 103 Family Scaffolds
COG4875	Protein kinase association domain CaMKII_AD, NTF2-like superfamily	Posttranslational modification, protein turnover, chaperones [O]	2.91
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	1.94
COG1671	Uncharacterized conserved protein YaiI, UPF0178 family	Function unknown [S]	0.97
COG5352	Uncharacterized conserved protein	Function unknown [S]	0.97

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.09 %
Unclassified	root	N/A	2.91 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.09 %
Unclassified	root	N/A	2.91 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.09 %
Unclassified	root	N/A	2.91 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	87.38 %
Unclassified	root	N/A	2.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.97 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	82.52 %
Unclassified	root	N/A	2.91 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.97 %

Name	Rank	Taxonomy	Distribution
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	79.61 %
Unclassified	root	N/A	2.91 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	0.97 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.97 %

Name	Rank	Taxonomy	Distribution
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	76.70 %
Unclassified	root	N/A	2.91 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.97 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples	0.97 %

Name	Rank	Taxonomy	Distribution
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	72.82 %
Unclassified	root	N/A	2.91 %
Rhodoblastus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus	0.97 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	8.74 %
Unclassified	root	N/A	2.91 %
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1.94 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples	0.97 %
Rhodoblastus sphagnicola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus sphagnicola	0.97 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
Sphingomonas sp. SE220	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	3.88 %
Unclassified	root	N/A	2.91 %
Sphingomonas sp. URHD0057	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1.94 %
Sphingomonas sp. SM33	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33	1.94 %
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1.94 %
uncultured Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.	0.97 %
Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	0.97 %
Rhodoblastus sphagnicola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus sphagnicola	0.97 %
uncultured Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000789\|JGI1027J11758_12498386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	687	Open in IMG/M
3300001989\|JGI24739J22299_10091386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	927	Open in IMG/M
3300002239\|JGI24034J26672_10041715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	772	Open in IMG/M
3300002568\|C688J35102_118862867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	606	Open in IMG/M
3300002568\|C688J35102_120144175	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300004156\|Ga0062589_100656247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	922	Open in IMG/M
3300004463\|Ga0063356_105480424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	545	Open in IMG/M
3300004643\|Ga0062591_101394746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	694	Open in IMG/M
3300004643\|Ga0062591_102465323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	546	Open in IMG/M
3300005093\|Ga0062594_101796265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	645	Open in IMG/M
3300005288\|Ga0065714_10285390	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	716	Open in IMG/M
3300005327\|Ga0070658_10468930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1086	Open in IMG/M
3300005327\|Ga0070658_10712365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	871	Open in IMG/M
3300005333\|Ga0070677_10209421	All Organisms → cellular organisms → Bacteria → Proteobacteria	946	Open in IMG/M
3300005334\|Ga0068869_101983562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	522	Open in IMG/M
3300005339\|Ga0070660_101468594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	580	Open in IMG/M
3300005434\|Ga0070709_10841980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	722	Open in IMG/M
3300005435\|Ga0070714_102293469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	525	Open in IMG/M
3300005458\|Ga0070681_11308121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	648	Open in IMG/M
3300005459\|Ga0068867_100964321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	771	Open in IMG/M
3300005535\|Ga0070684_101508093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	634	Open in IMG/M
3300005547\|Ga0070693_101057337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	617	Open in IMG/M
3300005549\|Ga0070704_101310445	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300005564\|Ga0070664_101006179	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300005564\|Ga0070664_101301619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	686	Open in IMG/M
3300005564\|Ga0070664_101651657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	607	Open in IMG/M
3300005578\|Ga0068854_100045071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3134	Open in IMG/M
3300005578\|Ga0068854_100868448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	791	Open in IMG/M
3300005587\|Ga0066654_10847340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	522	Open in IMG/M
3300005834\|Ga0068851_10320467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	895	Open in IMG/M
3300005840\|Ga0068870_10477173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	827	Open in IMG/M
3300006175\|Ga0070712_101282278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	638	Open in IMG/M
3300006806\|Ga0079220_10952051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	674	Open in IMG/M
3300009101\|Ga0105247_10819451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	712	Open in IMG/M
3300010044\|Ga0126310_11033069	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300010401\|Ga0134121_10282402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus sphagnicola	1463	Open in IMG/M
3300012212\|Ga0150985_116324657	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300012469\|Ga0150984_101899446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	732	Open in IMG/M
3300012469\|Ga0150984_111767738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	595	Open in IMG/M
3300012955\|Ga0164298_11689530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	502	Open in IMG/M
3300012986\|Ga0164304_10451606	All Organisms → cellular organisms → Bacteria → Proteobacteria	927	Open in IMG/M
3300012989\|Ga0164305_10475741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	977	Open in IMG/M
3300013104\|Ga0157370_10818733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	847	Open in IMG/M
3300013104\|Ga0157370_11305710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	654	Open in IMG/M
3300013296\|Ga0157374_12922407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	505	Open in IMG/M
3300013307\|Ga0157372_10696247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1182	Open in IMG/M
3300013307\|Ga0157372_10696276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1182	Open in IMG/M
3300014497\|Ga0182008_10248686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	916	Open in IMG/M
3300015371\|Ga0132258_10439009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	3252	Open in IMG/M
3300015372\|Ga0132256_103299646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	543	Open in IMG/M
3300015374\|Ga0132255_102377621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	809	Open in IMG/M
3300015374\|Ga0132255_102658747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	765	Open in IMG/M
3300018073\|Ga0184624_10458105	Not Available	559	Open in IMG/M
3300018920\|Ga0190273_10653487	Not Available	805	Open in IMG/M
3300020076\|Ga0206355_1223930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1572	Open in IMG/M
3300020078\|Ga0206352_10950040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	561	Open in IMG/M
3300025903\|Ga0207680_10775157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	687	Open in IMG/M
3300025903\|Ga0207680_11330606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	510	Open in IMG/M
3300025904\|Ga0207647_10637179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	585	Open in IMG/M
3300025904\|Ga0207647_10752809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	527	Open in IMG/M
3300025912\|Ga0207707_10295401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1401	Open in IMG/M
3300025913\|Ga0207695_10244682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1694	Open in IMG/M
3300025917\|Ga0207660_10150743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1786	Open in IMG/M
3300025923\|Ga0207681_11682669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	530	Open in IMG/M
3300025924\|Ga0207694_10657774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33	883	Open in IMG/M
3300025928\|Ga0207700_10359565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1269	Open in IMG/M
3300025929\|Ga0207664_11289608	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium	650	Open in IMG/M
3300025930\|Ga0207701_10172327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1912	Open in IMG/M
3300025931\|Ga0207644_11291933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33	613	Open in IMG/M
3300025932\|Ga0207690_10364822	All Organisms → cellular organisms → Bacteria	1145	Open in IMG/M
3300025932\|Ga0207690_10600745	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300025932\|Ga0207690_10634899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	874	Open in IMG/M
3300025933\|Ga0207706_10015018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	7012	Open in IMG/M
3300025933\|Ga0207706_10522122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1024	Open in IMG/M
3300025933\|Ga0207706_10546350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	997	Open in IMG/M
3300025935\|Ga0207709_10249255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1296	Open in IMG/M
3300025935\|Ga0207709_10582802	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300025938\|Ga0207704_10771009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	801	Open in IMG/M
3300025960\|Ga0207651_10127702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1940	Open in IMG/M
3300025960\|Ga0207651_10267792	All Organisms → cellular organisms → Bacteria → Proteobacteria	1406	Open in IMG/M
3300025972\|Ga0207668_11240881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	670	Open in IMG/M
3300026089\|Ga0207648_10773819	All Organisms → cellular organisms → Bacteria → Proteobacteria	892	Open in IMG/M
3300026319\|Ga0209647_1156149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	947	Open in IMG/M
3300027842\|Ga0209580_10285095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.	822	Open in IMG/M
3300028379\|Ga0268266_10305728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1485	Open in IMG/M
3300028380\|Ga0268265_11992437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	588	Open in IMG/M
3300028381\|Ga0268264_12344758	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300028590\|Ga0247823_10850356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	685	Open in IMG/M
3300031548\|Ga0307408_101659111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	608	Open in IMG/M
3300031720\|Ga0307469_11701079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	608	Open in IMG/M
3300031731\|Ga0307405_11673456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	563	Open in IMG/M
3300031852\|Ga0307410_10272408	All Organisms → cellular organisms → Bacteria → Proteobacteria	1325	Open in IMG/M
3300031852\|Ga0307410_11723222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	555	Open in IMG/M
3300031903\|Ga0307407_11536310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	527	Open in IMG/M
3300031903\|Ga0307407_11552614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	524	Open in IMG/M
3300031911\|Ga0307412_10216562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1465	Open in IMG/M
3300031939\|Ga0308174_11754316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	533	Open in IMG/M
3300031995\|Ga0307409_102612873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	533	Open in IMG/M
3300032002\|Ga0307416_100617125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1166	Open in IMG/M
3300032013\|Ga0310906_10170581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1291	Open in IMG/M
3300032013\|Ga0310906_10736846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	691	Open in IMG/M
3300032122\|Ga0310895_10449185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	640	Open in IMG/M
3300032421\|Ga0310812_10033814	Not Available	1891	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	62.14%
Environmental	Environmental	37.86%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	62.14%
Terrestrial	Environmental → Terrestrial	36.89%
Aquatic	Environmental → Aquatic	0.97%

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	42.72%
Soil	Environmental → Terrestrial → Soil	36.89%
Rhizoplane	Host-Associated → Plants → Rhizoplane	19.42%
Sediment	Environmental → Aquatic → Sediment	0.97%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.27%
Soil	Host-Associated → Plants → Rhizosphere → Soil	23.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	19.42%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.56%
Loam	Environmental → Terrestrial → Soil → Loam	12.62%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.97%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	23.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	19.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.68%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	9.71%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.88%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.97%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.97%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	11.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	8.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	7.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.88%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.91%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.94%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.94%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.94%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.97%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.97%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.97%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.97%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.97%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.97%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.97%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.97%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.97%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.97%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Host-Associated	Open in IMG/M
3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Host-Associated	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental	Open in IMG/M
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F099632

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J11758_124983863	3300000789	Soil	VEAVGSAENWHEERDRLVKLLEGIETGKITHIDENDLGQLQATNPE
JGI24739J22299_100913864	3300001989	Corn Rhizosphere	MEVIVSVENWHEERDRLVQLLRGIESGEITHIDEDDLREL
JGI24034J26672_100417151	3300002239	Corn, Switchgrass And Miscanthus Rhizosphere	VSAENWHEERDRLVRLLNAIESGKVTHIDEEDMRQLQATTPENVEALK
C688J35102_1188628671	3300002568	Soil	MGAENWHEERDRLIQLLKGIESGTITHIDEDDLRELQATSPENIAV
C688J35102_1201441751	3300002568	Soil	MEGAVSTENWTDERERLVKLLEGIDSGTVTHVDEEDFEQLQATNP
Ga0062589_1006562471	3300004156	Soil	VSAENWHQERDRLVRLLKAIKSGKITHIDEVDLRELQAANPENIAALE
Ga0063356_1054804243	3300004463	Arabidopsis Thaliana Rhizosphere	LQVEAEDIVSAENWHEERDRLVRLLKAIETGKVTHVDEED
Ga0062591_1013947463	3300004643	Soil	MAENWHQERDRLVHLLRAIEMGEVTHIDETDFRQLQATNPDNVASLKQR
Ga0062591_1024653231	3300004643	Soil	VSAENWHDERDRLVRLLKAIESGEVTHVDEEDMRQLQATTPENIE
Ga0062594_1017962651	3300005093	Soil	VSAENWHEERDRLVRLLKAIESGKVTHIDQSGDRQLQATNPENIVA
Ga0065714_102853901	3300005288	Miscanthus Rhizosphere	MLKAEDVVSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAA
Ga0070658_104689305	3300005327	Corn Rhizosphere	VSTENWAEERDRIVKLLEAIEAGTVTHIDEDELRQLQATTEDNVA
Ga0070658_107123651	3300005327	Corn Rhizosphere	VSVENWHEERDRLIELLEAIESGKVSHIDEEDLRQLQPTNPENI
Ga0070677_102094211	3300005333	Miscanthus Rhizosphere	VSAENWHEERDRLVKLLEGIETGKITHIDENDLRQLQATNEENIALLKE
Ga0068869_1019835623	3300005334	Miscanthus Rhizosphere	MSENWHDERDRLVRLLKAIESGKVTHVDEEDRRQLQATTPENIEGLK
Ga0070660_1014685942	3300005339	Corn Rhizosphere	VSTENWAEERARLERLLVDIESGKITHVDEEDLRQLQAINPGNIAAL
Ga0070709_108419803	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	VENWHEERDRLMQLLEGIESGKITHIDEADLRELQATSPENIA
Ga0070714_1022934691	3300005435	Agricultural Soil	VSAENWHEERDRLIELLEAIESGKVTHIDEEGLRQLQPTN
Ga0070681_113081211	3300005458	Corn Rhizosphere	MVNAENWHEERDRLVELLQGIESGKITHIDEEDLRELQAT
Ga0068867_1009643211	3300005459	Miscanthus Rhizosphere	MLKAEDVVSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAAT
Ga0070684_1015080931	3300005535	Corn Rhizosphere	VENWHEERDRLMQLLEGIESGKITHIDEADLRELQATSPENIAL
Ga0070693_1010573371	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	VSAESWHEERDRLVELLEAIESGKVTHIDEEDLRQLQPTNPENIA
Ga0070704_1013104452	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	VSAENWHEERDRLVELLQGIESGKVTHIDAEDLRQLQPTSPENIAVLKKR
Ga0070664_1010061792	3300005564	Corn Rhizosphere	VSAENWHEERDRLVELLQGIESGKVTHIDAEDLRQLQPTSPE
Ga0070664_1013016191	3300005564	Corn Rhizosphere	VTENWHEERDRLIKLLEGIGSGKITHIDEKELRQLQATNPENVALLRERLA
Ga0070664_1016516571	3300005564	Corn Rhizosphere	VSAENWHEERDRLIELLEAIESGKVTHIDEEDLRQLQPTNP
Ga0068854_1000450711	3300005578	Corn Rhizosphere	VSAENWHEERDRLIELLEAIESGKVTHIDEEDLRQLQPTN
Ga0068854_1008684483	3300005578	Corn Rhizosphere	VSAENWHEERDRLVQLLEGIESGKITHIDEADLRQLQATSPE
Ga0066654_108473402	3300005587	Soil	VSAENWHEERDRLSLLLQGIESGAVTHIDEEDLRQL
Ga0068851_103204671	3300005834	Corn Rhizosphere	VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPDNVARL
Ga0068870_104771733	3300005840	Miscanthus Rhizosphere	VSENWREERDRLIRLLAAIESGKITHVDEENLRQLQATSPENIELLKKR
Ga0070712_1012822781	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VSGENWHQERDRLVQLLKGIESGAITHIDKEDRQQLQA
Ga0079220_109520512	3300006806	Agricultural Soil	VSEENWHEERDRLIELLEAIESGKVTHIDEEDLRQLQ
Ga0105247_108194511	3300009101	Switchgrass Rhizosphere	VSAENWHEERERLIRLLKAIKSGKVTHIDEEDLRQLQATNPD
Ga0126310_110330691	3300010044	Serpentine Soil	VSAENWHEERDRLVQLLEAIESGRITHIDEEDLRQLQATNP
Ga0134121_102824023	3300010401	Terrestrial Soil	MSAENWHEERDRLVRLLKAIESGKITHIDEEDLRQLQATNPD
Ga0150985_1163246571	3300012212	Avena Fatua Rhizosphere	LSENWHEERDRLVALIEAVENGDVTHIDQGQLRQLQQ
Ga0150984_1018994463	3300012469	Avena Fatua Rhizosphere	MEAALSAENWHEERDRLVRLIKAIESGKVSHIDEEDLRQLQAT
Ga0150984_1117677381	3300012469	Avena Fatua Rhizosphere	VSAETWHEERERLVRLLKAIESGDVTHIDQEGLRPLQATNPENVVVLK
Ga0164298_116895301	3300012955	Soil	MVSAENWHEERDRLVQLLKGIESGAITHIDEEDLRELQATSPENVELL
Ga0164304_104516063	3300012986	Soil	MSAENWHEERDRLIELLKAIESGDVTHIDEEDLRQLQPTNP
Ga0164305_104757411	3300012989	Soil	MVSAENWHEERDRLVQLLKGIESGAITHIDEEDLRELQATSPENV
Ga0157370_108187333	3300013104	Corn Rhizosphere	MSAENWHEERDRLVRLLEGIESGKVTHVDQEHLTELQATSPKNIAMLKNR
Ga0157370_113057101	3300013104	Corn Rhizosphere	VSVENWHEERERLVQLLEGIESGKITHIDVEDLRELQA
Ga0157374_129224072	3300013296	Miscanthus Rhizosphere	MSAENWHEERDRLVRLLEGIESGKVTHVDQEHLTELQATSPKNI
Ga0157372_106962474	3300013307	Corn Rhizosphere	VSAENWHEERDRLIELLEAIESGKVTHIDEEDMRQLQP
Ga0157372_106962765	3300013307	Corn Rhizosphere	VSVENWHEERERLVQLLEGIESGKITHIDVEDLRELQATSP
Ga0182008_102486863	3300014497	Rhizosphere	VSVENWHEERDRLVKLLKGIESGKITHVDENGLRQLQATNPENIAWIK
Ga0132258_104390091	3300015371	Arabidopsis Rhizosphere	MLPDRVAEVVVSAENWHEERDRLVRLLKAIETGDVTHIDEDDMRQLQAT
Ga0132256_1032996463	3300015372	Arabidopsis Rhizosphere	MAENWHQERDRLVHLLRAIEMGEVTHIDETDLRQLQATNPDNVA
Ga0132255_1023776214	3300015374	Arabidopsis Rhizosphere	MSAETWHEERDRLVRLLEAIKSGDVTHIDEQDQRQLQET
Ga0132255_1026587471	3300015374	Arabidopsis Rhizosphere	VSEENWHEERDRLVELLEAVESGTVTHIDEEDLRQLQPTNPDNIAVLRE
Ga0184624_104581052	3300018073	Groundwater Sediment	MENPVSTENWAEERDRLRQLLNDFESGKITHFDEGDDG
Ga0190273_106534871	3300018920	Soil	MSTETWSEERARLLRLLDGIESGEITHINEGDLRE
Ga0206355_12239301	3300020076	Corn, Switchgrass And Miscanthus Rhizosphere	VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPDNVARLKD
Ga0206352_109500402	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPD
Ga0207680_107751573	3300025903	Switchgrass Rhizosphere	MTAETWHEERDRLVLLLEGIKAGRITHIDEKDQRELKP
Ga0207680_113306062	3300025903	Switchgrass Rhizosphere	MSAENWHEERDRLVQLLEGIESGKVTHIDESDDRQLEAANPKN
Ga0207647_106371791	3300025904	Corn Rhizosphere	VTSENWHEERDRLVELLAGIESGRITHIDVDNLRQLRATSPQNIAVVR
Ga0207647_107528091	3300025904	Corn Rhizosphere	MSAENWHEERDRLIELLKAIESGDVTHIDEEDLRQLQPTNPDNIAIL
Ga0207707_102954015	3300025912	Corn Rhizosphere	VSVENWHEERDRLAQLLKGIESGKITHIDEADLRE
Ga0207695_102446821	3300025913	Corn Rhizosphere	VSAENWHEERNRIVELLEAIESGKVTHIDEENLRQLAPTNPKNIALLRKG
Ga0207660_101507436	3300025917	Corn Rhizosphere	VNAENWHEERDRLVLLLKAIESGTITHIDEEALRQLQATNPDNVAR
Ga0207681_116826691	3300025923	Switchgrass Rhizosphere	VSAENWHDERDRLVRLLKAIESGEVTHVDEEDMRQLQATTPENIET
Ga0207694_106577742	3300025924	Corn Rhizosphere	MSAENWHEERDRLVRLLKAIESGKITHIDEEDLRQLQATNPDTI
Ga0207700_103595651	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	VGGENWREERDRLVQLLEGIESGKVTHIDEADLRELQATTPENIEVLKK
Ga0207664_112896081	3300025929	Agricultural Soil	VSAENWHEERDRLIELLEAIESGKVTHIDEEGLRQL
Ga0207701_101723271	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VSAENWHEERDRIVQLLSGIESGKITHIDEKDLRELQATSPEN
Ga0207644_112919331	3300025931	Switchgrass Rhizosphere	MSAENWHEERDRLVRLLKAIESGKITHIDERDLRVLQAATPENIAALKQR
Ga0207690_103648222	3300025932	Corn Rhizosphere	VSAENWHEERDRLVELLQGIESGKVTHIDAEDLRQLQPTSPENIAMLKKR
Ga0207690_106007451	3300025932	Corn Rhizosphere	VTAENWHEERDRLIQLLQGIESGRITHIDEDDLRQ
Ga0207690_106348991	3300025932	Corn Rhizosphere	VSVENWHEERDRLIELLEAIESGKVSHIDEEDLRQLQPTNPENIALL
Ga0207706_1001501813	3300025933	Corn Rhizosphere	VSAENWHEERDRLVRLLNAIESGKVTHIDEEDMRQL
Ga0207706_105221221	3300025933	Corn Rhizosphere	MEAAVSAENWHEERDRIAQLLDGIESGKITHIDEEDLRQLQATNPENVALL
Ga0207706_105463504	3300025933	Corn Rhizosphere	VSVENWHEERDRLVQLLRGIESGEITHIDEDDLRELQAT
Ga0207709_102492555	3300025935	Miscanthus Rhizosphere	VSENWREERDRLVRLLAAIESGEITHIDEADQRQLQAASPENI
Ga0207709_105828021	3300025935	Miscanthus Rhizosphere	VSAENWHEERDRLVQLLKAIESGKVTHIDEEDLRQLQ
Ga0207704_107710093	3300025938	Miscanthus Rhizosphere	VSAENWHEERDRLVQLLKAIESGKVTHIDEEDLRQLQAANP
Ga0207651_101277021	3300025960	Switchgrass Rhizosphere	VSENWREERDRLIRLLAAIESGKITHVDEENLRQLQATSPENI
Ga0207651_102677924	3300025960	Switchgrass Rhizosphere	MSAENWHEERDRLIELLKAIESGDVTHIDEEDLRQLQP
Ga0207668_112408813	3300025972	Switchgrass Rhizosphere	MSAENWHEERDRLVRLLEGIESGKVTHVDQEHLTELQATSP
Ga0207648_107738191	3300026089	Miscanthus Rhizosphere	MLKAEDVVSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAATP
Ga0209647_11561491	3300026319	Grasslands Soil	VSVENWHEERDRLARLLKAVESGKITHVDEEDLRQLQA
Ga0209580_102850953	3300027842	Surface Soil	VSTENWHEERDRLRQLLKGIESGKITHIDEDDLRQLQ
Ga0268266_103057282	3300028379	Switchgrass Rhizosphere	MSPENWHEERDRLIKLLEGIESGEVTHVDESIDRQLEATNPKNVAG
Ga0268265_119924371	3300028380	Switchgrass Rhizosphere	VSAENWHEERDRLVKLLEGIESGKITHIDEKELRQLQAT
Ga0268264_123447582	3300028381	Switchgrass Rhizosphere	MEAAVSAENWHEERDRIAQLLDGIESGKITHIDEEDLRQLQATN
Ga0247823_108503561	3300028590	Soil	VSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAATPE
Ga0307408_1016591111	3300031548	Rhizosphere	VSAENWHEERDRLVRLLKAIETGKITHVDEEDLRELQA
Ga0307469_117010793	3300031720	Hardwood Forest Soil	VSAENWHEERDRLVELLHAIESGKVTHIDEEDLRQLQPTNPENV
Ga0307405_116734561	3300031731	Rhizosphere	VSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQAATPENIAALKQR
Ga0307410_102724084	3300031852	Rhizosphere	VSAENWHEERDRLVQLLAGIETGKITHIDEHDLRQLQATSPENVALLKE
Ga0307410_117232221	3300031852	Rhizosphere	VSTENWHQERDRLVRLLKAIESGTVTHVDEEDLRQLQATTPEN
Ga0307407_115363103	3300031903	Rhizosphere	VRAETWHEERNRLVRLLHAIEMGDITHIDEDGLRQLQATNADNVSF
Ga0307407_115526141	3300031903	Rhizosphere	VSAENWHEERDRLVRLLEAIESGKVTHVDEEDMRQLQAT
Ga0307412_102165621	3300031911	Rhizosphere	VNTENWHEERDRLVRLLKAIESGTVTHVDEEDLRQLQAATP
Ga0308174_117543161	3300031939	Soil	VSAENWHEERDRLIRLLEAIESGKITHVDEDDLRQLQATNPHNIAR
Ga0307409_1026128732	3300031995	Rhizosphere	VSAENWHEERDRLVRLLKAIETGKVTHIDQKDLRQLQATTPENVEAL
Ga0307416_1006171252	3300032002	Rhizosphere	VSTENWTEERERLVRLLEAIEAGKITHVNEDDLRQL
Ga0310906_101705814	3300032013	Soil	VSAENWHEERDRLVRLLKAIETGKVTHVDEEDLRELQA
Ga0310906_107368461	3300032013	Soil	VSEENWHEERDRLVELLEAIESGTVTHIDEEDLRQLQP
Ga0310895_104491853	3300032122	Soil	VSAETWREERDRLVRLLKAIKSGKITHVDEEDLRELQATTPENIA
Ga0310812_100338145	3300032421	Soil	VSVENWHEERDRLAQLLKGIESGKITHIDEEDLRQLQ

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign