| Basic Information | |
|---|---|
| Family ID | F099629 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | QQYLPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWTA |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.97 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.029 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.214 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02566 | OsmC | 27.18 |
| PF02656 | DUF202 | 11.65 |
| PF04542 | Sigma70_r2 | 3.88 |
| PF08281 | Sigma70_r4_2 | 2.91 |
| PF02574 | S-methyl_trans | 2.91 |
| PF06197 | DUF998 | 1.94 |
| PF11716 | MDMPI_N | 1.94 |
| PF00248 | Aldo_ket_red | 1.94 |
| PF12730 | ABC2_membrane_4 | 1.94 |
| PF00196 | GerE | 1.94 |
| PF13527 | Acetyltransf_9 | 1.94 |
| PF00561 | Abhydrolase_1 | 0.97 |
| PF11258 | DUF3048 | 0.97 |
| PF00668 | Condensation | 0.97 |
| PF14224 | DUF4331 | 0.97 |
| PF08241 | Methyltransf_11 | 0.97 |
| PF00933 | Glyco_hydro_3 | 0.97 |
| PF00484 | Pro_CA | 0.97 |
| PF13649 | Methyltransf_25 | 0.97 |
| PF11774 | Lsr2 | 0.97 |
| PF13823 | ADH_N_assoc | 0.97 |
| PF13814 | Replic_Relax | 0.97 |
| PF13560 | HTH_31 | 0.97 |
| PF01594 | AI-2E_transport | 0.97 |
| PF04539 | Sigma70_r3 | 0.97 |
| PF01850 | PIN | 0.97 |
| PF01243 | Putative_PNPOx | 0.97 |
| PF00903 | Glyoxalase | 0.97 |
| PF01670 | Glyco_hydro_12 | 0.97 |
| PF12680 | SnoaL_2 | 0.97 |
| PF00583 | Acetyltransf_1 | 0.97 |
| PF00730 | HhH-GPD | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 27.18 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 27.18 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 11.65 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 4.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 4.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 3.88 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 3.88 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 2.91 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 2.91 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 1.94 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.97 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.97 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.97 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.03 % |
| All Organisms | root | All Organisms | 0.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_101545248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018933 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 42 hrs v1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20190J14840_10098342 | 3300001384 | Arctic Peat Soil | DRQYLPGVNGDFDVVYAIRPQSAMAWRLDDYDASQRRWTS* |
| Ga0062385_106389171 | 3300004080 | Bog Forest Soil | PEDQQYLPDHDPDFDVVYALRPQSAMAWRLDDYAASQRRWRADLW* |
| Ga0063454_1015452482 | 3300004081 | Soil | MLSPDHDPDFDVVYAVRPRSALAWRLDDYAASQRRWTALS* |
| Ga0070683_1013784602 | 3300005329 | Corn Rhizosphere | WPEDQQFLPASDPDFDVVWAVRPRSALAWRLVDYDGSQRRWTAGPPG* |
| Ga0066388_1070968781 | 3300005332 | Tropical Forest Soil | PEDQQFLPASDPDFDVVWAVRPRSALTWRLVDYDVSHRRWTAG* |
| Ga0070687_1004032373 | 3300005343 | Switchgrass Rhizosphere | EDQQFLPASDPDFDVVWAVQPRSALAWRLVDYDGSQRRWTAG* |
| Ga0070733_105979373 | 3300005541 | Surface Soil | DGQYLPHADPAFDVLYAIRPRSAMAWRLADYDGSQRRWPGVS* |
| Ga0070665_1024736611 | 3300005548 | Switchgrass Rhizosphere | YLPSEDPDFDVLYVIRPHRAMTWQLDDFDASQRRWRA* |
| Ga0070761_104425631 | 3300005591 | Soil | PSNDPDFDVVYALRPQSAMAWRLHDYTASQRRWSC* |
| Ga0066903_1061206941 | 3300005764 | Tropical Forest Soil | GQGDRQYLPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWTS* |
| Ga0066787_100981402 | 3300005950 | Soil | DADPDFDVVYAIRPQSAMMWRLADYEASQRRWTS* |
| Ga0066789_103419022 | 3300005994 | Soil | AGDQQYLPDADPDFDVVYAIRPQSAMTWRLADYEASQRRWTS* |
| Ga0075017_1014539531 | 3300006059 | Watersheds | YLPDHDPDFDVVYALRPQSAMAWRLDDYAASQRRWLADLW* |
| Ga0070712_1015279851 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LPDHDPDFDVVWAIRPRSAMAWRLDDYAASQRRWTALS* |
| Ga0068871_1018241092 | 3300006358 | Miscanthus Rhizosphere | QQFLPASDPDFDVVWAVRPRSALAWRLVDYEVSQRRWTAG* |
| Ga0079222_101618111 | 3300006755 | Agricultural Soil | APGDRQYLPDADPAFDVVYAVRPRSALAWRLADYDGSQRRWAGES* |
| Ga0075436_1005480512 | 3300006914 | Populus Rhizosphere | VSARCDPDFDVVYAIRAQSAIMWRLADYEASQRRWTR* |
| Ga0116106_11297422 | 3300009645 | Peatland | KYTSQADQQYLPDTDPDFDVVYARRLSDYEASQRRWSG* |
| Ga0126382_111219371 | 3300010047 | Tropical Forest Soil | LPDTDPDFDVVYAIRPQSAMMWRLADYDASQRRWTS* |
| Ga0126370_110047151 | 3300010358 | Tropical Forest Soil | QYLPDHDPGFDVVYAVRPRSAMAWRLDDYAASQRRWPALS* |
| Ga0126370_125611222 | 3300010358 | Tropical Forest Soil | HADRQYLPDADPDFDVVYAIRPTSAVAWLLADYARSQRRWSL* |
| Ga0126379_124860682 | 3300010366 | Tropical Forest Soil | GDRQYLPDADPDFDVVYAIRPQSAMIWRLADYEASQRRWTS* |
| Ga0134125_111261161 | 3300010371 | Terrestrial Soil | KYTGPQDQQYLPDHDPDFDVVWAIRPLSAVAWRLDDYDASQRRWSPLW* |
| Ga0126381_1007692623 | 3300010376 | Tropical Forest Soil | GEGDQQYLPDADPDFDVVYAIRPQSAMMWRLANYEASQRRWTS* |
| Ga0137380_102674711 | 3300012206 | Vadose Zone Soil | MNTRPQDRQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQ |
| Ga0137385_100529311 | 3300012359 | Vadose Zone Soil | MNTRPQDRQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQR |
| Ga0137390_115412582 | 3300012363 | Vadose Zone Soil | YTRPEDQRYLPGADPDFDVIYALRPQSAMTWRLNDYAASQRRWSS* |
| Ga0137390_116482141 | 3300012363 | Vadose Zone Soil | DQQYLPDHDPGFDVVYALRPRSALAWRLDDYAASQHRWSAVLW* |
| Ga0137413_117446031 | 3300012924 | Vadose Zone Soil | SPQDRQYLPDHDPDFDVVYAVRPRSALAWRLADYAVSQRRWTALS* |
| Ga0137416_119870771 | 3300012927 | Vadose Zone Soil | QQYLPGADPDFDVVYAIRPQSAMAWRLDDYAASQRRWSS* |
| Ga0164300_104822461 | 3300012951 | Soil | QQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLW* |
| Ga0126369_114145113 | 3300012971 | Tropical Forest Soil | QYLPDADPAVDVVYAVRPRSAMAWRLADYDGSQRRWAAG* |
| Ga0182036_104219592 | 3300016270 | Soil | YTRPEDRQYLPDCDPDFDVVWAIRPRSAMAWRLDDYAASQRRWPALS |
| Ga0182041_114386201 | 3300016294 | Soil | PYLPDHDPDFDVVWAIRPRSAMAWRLDDYAASQRRWPALS |
| Ga0187812_13039473 | 3300017821 | Freshwater Sediment | PEDRQYLPDADPGFDVVYALRPRSALAWRLDDYTASQRRWSFGS |
| Ga0187809_100868271 | 3300017937 | Freshwater Sediment | YLPDGDPDFDIVYAINPQSAMMWHLADYEGSQRRWTS |
| Ga0187777_107027911 | 3300017974 | Tropical Peatland | QDQQYLPDHDPDFDVVYALRPQSALAWRLDDYEASQRRWLAVLW |
| Ga0187788_103500403 | 3300018032 | Tropical Peatland | YTGEGDRQYLPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWTC |
| Ga0187875_107379441 | 3300018035 | Peatland | KYTRPEDQQYLPSNDPDFDVVYALRPQSAMAWRLNDYTASQRRWSC |
| Ga0066655_104334551 | 3300018431 | Grasslands Soil | YTRPQDQQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLG |
| Ga0193614_11042652 | 3300018933 | Soil | AYLPTGDASFDVVYAVRPTAALTWRLADFAASQRRWRGD |
| Ga0210407_100857224 | 3300020579 | Soil | GRYLPDRDPDFDVVWAIRPRSAMAWRLDDYAASQRRWTALS |
| Ga0210399_103982141 | 3300020581 | Soil | RRYLPDRDPDFDVVWAIRPRSAMAWRLDDYAASQRRWPGLS |
| Ga0210400_102483841 | 3300021170 | Soil | YLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLG |
| Ga0210397_111975642 | 3300021403 | Soil | QDQQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLW |
| Ga0210389_112605961 | 3300021404 | Soil | RPQDQQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLW |
| Ga0210386_105590213 | 3300021406 | Soil | RPQDQQYLPDYDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLG |
| Ga0210390_101277121 | 3300021474 | Soil | DVDPAVDVVYALRPRSALAWRLDDYAGSQRRWSVLG |
| Ga0210390_110733352 | 3300021474 | Soil | QQYLPDHDPDFDVVWAIRPRSAMAWRLDDYDASQRRWSPLG |
| Ga0126371_118032261 | 3300021560 | Tropical Forest Soil | GDRQYLPDADPDFDVVYAVRPQSALLWRLADYEASQRRWSS |
| Ga0247672_10675552 | 3300024187 | Soil | YTWPEDQQFLPASDPDFDVVWAVRPRSALAWRLVDYDGSQRRWTAGPPE |
| Ga0247667_10628661 | 3300024290 | Soil | WPEDQQFLPASDPDFDVVWAVRPRSALAWRLVDYDRSQRRWTAAPPG |
| Ga0247678_10073131 | 3300024325 | Soil | ASDPDFDVVWAVQPRSALAWRLVDYDGSQRRWTAG |
| Ga0208220_11515882 | 3300025627 | Arctic Peat Soil | LPGVNGDFDVVYAIRPQSAMAWRLDDYDASQRRWTS |
| Ga0207663_100813864 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QFLPASDPDYDVVWAVRPRSALAWRLVDYDGSQRRWTAGPPG |
| Ga0207663_111291042 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PYLPAADPDFDVVYAIRPRSAMAWRMSDYFASQRRWKA |
| Ga0207700_102635121 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QYLPDEDPDFDVVYAIRPTSAVAWQLADYAGSQRRWSP |
| Ga0207668_101921814 | 3300025972 | Switchgrass Rhizosphere | QYLPDHDPDFDVVWAIRPLSAVAWRLDDYDASQRRWSPLW |
| Ga0207677_102397181 | 3300026023 | Miscanthus Rhizosphere | LAAKYTGPQDQQYLPDHDPDFDVVWAIRPLSAVAWRLDDYDASQRRWSPLW |
| Ga0207676_102351301 | 3300026095 | Switchgrass Rhizosphere | AKYTGPQDQQYLPDHDPDFDVVWAIRPLSAVAWRLDDYDASQRRWSPLW |
| Ga0207698_106636373 | 3300026142 | Corn Rhizosphere | DHDPDFDVVWAIRPLSAVAWRLDDYDASQRRWSPLW |
| Ga0257146_10250873 | 3300026374 | Soil | DRDPDFDVVWAIRPRSAMAWRLDDYAASQRRWSPLW |
| Ga0209529_10166212 | 3300027334 | Forest Soil | DPDFDIVYALRPQSALMWRLADYEGSQRRWTPWAEQTSRD |
| Ga0209446_11207102 | 3300027698 | Bog Forest Soil | QQYLPDHDPDFDVVYALRPQSAMAWRLDDYAASQRRWRADLW |
| Ga0209112_102116202 | 3300027817 | Forest Soil | EADRPYLPDADPAFDIVYAVRPQSAMMWRLPGYEGSQRRWTP |
| Ga0209039_100553344 | 3300027825 | Bog Forest Soil | QYLPDHDPDFDVVYALRPRSAMAWRLDDYAASQRRWRADLW |
| Ga0307297_102633722 | 3300028754 | Soil | DPAVDVVYALDPRQALSWRLADFENSQRRWEATGSPGPT |
| Ga0302235_101542721 | 3300028877 | Palsa | RYLPSNDPDFDVVYALRPQSAMAWRLDDYSASQRRWSR |
| Ga0311368_102755581 | 3300029882 | Palsa | QYLPSNDPDFDVVYALRPQSAMAWRLDDFTASQRRWSC |
| Ga0311370_120546111 | 3300030503 | Palsa | YTRAEDQQYLPGNDPDFDVVYALRPQSAMAWRLDDYSASQRRWSC |
| Ga0265327_103513641 | 3300031251 | Rhizosphere | PSHDPDFDVLWALRATSALRWLLDDYDASQLRWSAH |
| Ga0318528_106057343 | 3300031561 | Soil | ADPDFDVVYAIRPRSATAWRLADYDGSQRRWAGQG |
| Ga0318555_101855384 | 3300031640 | Soil | YADPADRPYLPDADPDFDVVYAIRPHTAMAWRLDAYEASQRRWPG |
| Ga0318555_103185601 | 3300031640 | Soil | YIAEADRQYLPEADPDFDVVYAIRPRSAMMWRLADYEASQRRWSC |
| Ga0318574_103149241 | 3300031680 | Soil | QYLPDADPGFDVVYAIRPRSAMVWRLADYAASQRRWSA |
| Ga0310686_1170798073 | 3300031708 | Soil | PDADPAFDVVYAVRPRSAIAWRLDDYTDSQRRWSF |
| Ga0318496_103020151 | 3300031713 | Soil | KYTDPADRPYLPGADPDFDVVYAIRPHTAMAWRLDDYDASQRRWPG |
| Ga0318494_100109345 | 3300031751 | Soil | ARRDPDFDVVYAVRLQSAMMWRLADYEASQRRWTS |
| Ga0318526_101713291 | 3300031769 | Soil | YLPDRDPDFDVVWAIRPRSAMAWRLDDYTASQRRWPALS |
| Ga0318547_104756451 | 3300031781 | Soil | YTAPADRPYLPDADPGFDVVYAIRPRLAMTWRLPDYDGSQRRWSA |
| Ga0318552_104958911 | 3300031782 | Soil | KYTAPADRPYLPDADPGFDVVYAIRPRLAMTWRLPDYDGSQRRWSA |
| Ga0318548_104058901 | 3300031793 | Soil | LPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWRC |
| Ga0318568_100636771 | 3300031819 | Soil | CAPRRPRARRDPDFDVVYAVRLQSAMMWRLADYEASQRRWTS |
| Ga0318495_105433692 | 3300031860 | Soil | TRPEDQQYLPDRDPDFDVVWAIRPRSAMAWRLDDYASSQRRWPALS |
| Ga0318551_103662101 | 3300031896 | Soil | YLPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWRC |
| Ga0306923_113691581 | 3300031910 | Soil | APGDRQYLPDADPAFDLVYAVRPRSAMAWRLADYDGSQRRWAAD |
| Ga0306921_121300961 | 3300031912 | Soil | KYTAPGDRRYLPDADPDFDVVYAVRPRSAMAWRLADYDGSQRRWPA |
| Ga0310913_102936903 | 3300031945 | Soil | EDRQYLPDADLAFDVVYALRPRSALAWRLDDYEASQRRWSFGS |
| Ga0318569_103370541 | 3300032010 | Soil | YTRPEDQQYLPDRDPDFDVVWAIRPRSAMAWRLDDYAASQRRWPALS |
| Ga0318507_103665983 | 3300032025 | Soil | PRPCLPDADPDFDVVYAIRPHTAMAWRLDAYEASQRRWPG |
| Ga0318558_106678471 | 3300032044 | Soil | PDADPDFDVVYAIRPQSAIMWRLADYEASQRRWTS |
| Ga0318505_102525902 | 3300032060 | Soil | GERDRQYLPDADPDFDVVHAIRPQSAMMMMMMWRLADYEASQRRWTS |
| Ga0318510_104120011 | 3300032064 | Soil | LPDADPGFDVVYALRPRSALAWRLDDYEASQRRWTFGS |
| Ga0318524_106375621 | 3300032067 | Soil | KYTRPQDQPYLPDHDPDFDVVYALRPRSALAWRMDDYEASQRRWRAV |
| Ga0318518_102083512 | 3300032090 | Soil | LPDADPDFDVVHAIRPQSAMMMMMMMWRLADYEASQRRWTS |
| Ga0318577_101557151 | 3300032091 | Soil | QYLPDADPAFDVVYTVRPRSAMAWRLADYDGSQRRWAGQG |
| Ga0335079_109838151 | 3300032783 | Soil | QQYLPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWTA |
| Ga0335078_124373282 | 3300032805 | Soil | DQQYLPDHDPDFDVVWAIRPRSAMAWRLDDYAASQRRWPALS |
| Ga0335080_118618153 | 3300032828 | Soil | PDFDVIYAIRPVSALAWRLDDYDASQRRWAQVETSG |
| Ga0335080_121622572 | 3300032828 | Soil | LPDADPDFDVVYAIRPQSAMMWRLADYEASQRRWTA |
| Ga0335076_117200342 | 3300032955 | Soil | LPAEDPDFDVVYAIRPQSAMAWRMSDYFASQRRWSAH |
| Ga0335077_104851341 | 3300033158 | Soil | QYLPDADPDFDVVYAFRPQSAMAWRLDDYEASQRRWSAALR |
| Ga0310914_100686441 | 3300033289 | Soil | DRQYLPDADPDFDVVHAIRPQSAMMMMMMWRLADYEASQRRWTS |
| ⦗Top⦘ |