| Basic Information | |
|---|---|
| Family ID | F099598 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 48 residues |
| Representative Sequence | GTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.94 % |
| % of genes near scaffold ends (potentially truncated) | 96.12 % |
| % of genes from short scaffolds (< 2000 bps) | 93.20 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.699 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.505 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.184 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF04417 | DUF501 | 80.58 |
| PF02541 | Ppx-GppA | 14.56 |
| PF02803 | Thiolase_C | 0.97 |
| PF00535 | Glycos_transf_2 | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF03167 | UDG | 0.97 |
| PF00578 | AhpC-TSA | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1507 | Uncharacterized conserved protein, DUF501 family | Function unknown [S] | 80.58 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 29.13 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.97 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.70 % |
| Unclassified | root | N/A | 23.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01DKGL8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 2199352024|deeps__Contig_177395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1064 | Open in IMG/M |
| 2199352025|deepsgr__Contig_159680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1490 | Open in IMG/M |
| 3300005167|Ga0066672_10838547 | Not Available | 575 | Open in IMG/M |
| 3300005168|Ga0066809_10122974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 653 | Open in IMG/M |
| 3300005179|Ga0066684_10942336 | Not Available | 561 | Open in IMG/M |
| 3300005338|Ga0068868_100913577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
| 3300005339|Ga0070660_100256345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1427 | Open in IMG/M |
| 3300005434|Ga0070709_10324784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1130 | Open in IMG/M |
| 3300005435|Ga0070714_100173088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1960 | Open in IMG/M |
| 3300005435|Ga0070714_100565660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1089 | Open in IMG/M |
| 3300005436|Ga0070713_100783577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 913 | Open in IMG/M |
| 3300005445|Ga0070708_101468279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 636 | Open in IMG/M |
| 3300005467|Ga0070706_100149267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2182 | Open in IMG/M |
| 3300005467|Ga0070706_101716681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 572 | Open in IMG/M |
| 3300005518|Ga0070699_100285777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1478 | Open in IMG/M |
| 3300005548|Ga0070665_102162503 | Not Available | 560 | Open in IMG/M |
| 3300005598|Ga0066706_11131868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300005614|Ga0068856_102266406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300005615|Ga0070702_100031508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2903 | Open in IMG/M |
| 3300005841|Ga0068863_100283865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1604 | Open in IMG/M |
| 3300006028|Ga0070717_10553771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1041 | Open in IMG/M |
| 3300006028|Ga0070717_11398339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 635 | Open in IMG/M |
| 3300006059|Ga0075017_101458355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 539 | Open in IMG/M |
| 3300006176|Ga0070765_100299700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1485 | Open in IMG/M |
| 3300006237|Ga0097621_101689728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 603 | Open in IMG/M |
| 3300006806|Ga0079220_10351161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 938 | Open in IMG/M |
| 3300006914|Ga0075436_101513664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 510 | Open in IMG/M |
| 3300006954|Ga0079219_10842650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
| 3300006954|Ga0079219_10888851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 718 | Open in IMG/M |
| 3300009101|Ga0105247_11634901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300010323|Ga0134086_10198029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300010366|Ga0126379_11598059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300010371|Ga0134125_12123022 | Not Available | 611 | Open in IMG/M |
| 3300010373|Ga0134128_10845303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300010396|Ga0134126_10751948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300010396|Ga0134126_11857993 | Not Available | 660 | Open in IMG/M |
| 3300010401|Ga0134121_12740195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300010869|Ga0126359_1716032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300010877|Ga0126356_10864293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300012200|Ga0137382_10768153 | Not Available | 692 | Open in IMG/M |
| 3300012349|Ga0137387_10582899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300012359|Ga0137385_11375205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 569 | Open in IMG/M |
| 3300012474|Ga0157356_1014461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 584 | Open in IMG/M |
| 3300012925|Ga0137419_11275877 | Not Available | 617 | Open in IMG/M |
| 3300012960|Ga0164301_10485758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300012989|Ga0164305_12098758 | Not Available | 518 | Open in IMG/M |
| 3300014493|Ga0182016_10772258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 536 | Open in IMG/M |
| 3300016270|Ga0182036_11366582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300016294|Ga0182041_11969513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300016357|Ga0182032_10333662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1208 | Open in IMG/M |
| 3300017937|Ga0187809_10175374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300017947|Ga0187785_10530035 | Not Available | 592 | Open in IMG/M |
| 3300017999|Ga0187767_10363222 | Not Available | 513 | Open in IMG/M |
| 3300018025|Ga0187885_10509765 | Not Available | 536 | Open in IMG/M |
| 3300020582|Ga0210395_10307897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300021374|Ga0213881_10575819 | Not Available | 512 | Open in IMG/M |
| 3300021384|Ga0213876_10766161 | Not Available | 514 | Open in IMG/M |
| 3300021475|Ga0210392_10370687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300021475|Ga0210392_10434515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300021478|Ga0210402_10416738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
| 3300021559|Ga0210409_10563906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300021559|Ga0210409_10790447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300024271|Ga0224564_1112009 | Not Available | 557 | Open in IMG/M |
| 3300024283|Ga0247670_1021773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
| 3300024288|Ga0179589_10189004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 896 | Open in IMG/M |
| 3300024288|Ga0179589_10238981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300025898|Ga0207692_10357987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300025908|Ga0207643_10093812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
| 3300025913|Ga0207695_10278460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1567 | Open in IMG/M |
| 3300025928|Ga0207700_11154036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300025938|Ga0207704_10235782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1364 | Open in IMG/M |
| 3300025939|Ga0207665_10035970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3290 | Open in IMG/M |
| 3300026067|Ga0207678_10013774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7105 | Open in IMG/M |
| 3300026490|Ga0257153_1104143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300026552|Ga0209577_10778236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300027725|Ga0209178_1275500 | Not Available | 614 | Open in IMG/M |
| 3300027787|Ga0209074_10193167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 760 | Open in IMG/M |
| 3300028716|Ga0307311_10022302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1584 | Open in IMG/M |
| 3300028801|Ga0302226_10126035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300030509|Ga0302183_10161413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300030524|Ga0311357_11383640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 600 | Open in IMG/M |
| 3300031525|Ga0302326_11345063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
| 3300031640|Ga0318555_10674223 | Not Available | 559 | Open in IMG/M |
| 3300031748|Ga0318492_10675241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300031754|Ga0307475_11469415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300031797|Ga0318550_10636616 | Not Available | 512 | Open in IMG/M |
| 3300031893|Ga0318536_10439555 | Not Available | 658 | Open in IMG/M |
| 3300031941|Ga0310912_11020672 | Not Available | 634 | Open in IMG/M |
| 3300031942|Ga0310916_10720431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300031946|Ga0310910_11413561 | Not Available | 535 | Open in IMG/M |
| 3300032009|Ga0318563_10478580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300032065|Ga0318513_10365810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 703 | Open in IMG/M |
| 3300032205|Ga0307472_101694628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 624 | Open in IMG/M |
| 3300032261|Ga0306920_102026811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300032770|Ga0335085_10087765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4061 | Open in IMG/M |
| 3300032770|Ga0335085_11768506 | Not Available | 634 | Open in IMG/M |
| 3300032783|Ga0335079_11791188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300032828|Ga0335080_10918533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300032892|Ga0335081_10850954 | Not Available | 1082 | Open in IMG/M |
| 3300032893|Ga0335069_10082956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4090 | Open in IMG/M |
| 3300032955|Ga0335076_11743738 | Not Available | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.97% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.97% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_3812380 | 2035918004 | Soil | GSQPRISSAQTTKSGPAPWYDKLWRSVQQADASTAK |
| deeps_03304250 | 2199352024 | Soil | MCFPGTRCYIVEGSQPRSARPRRPRQGPAPWYDKLWRSVQQADAGPESKAK |
| deepsgr_02647930 | 2199352025 | Soil | SRTSTAQAAKPGPASWYDKLWRSVQQADAGPESKAK |
| Ga0066672_108385471 | 3300005167 | Soil | TCYIVTGGQSPASTARPSKPGPAPWYDKLWRSVQQADANPESTAK* |
| Ga0066809_101229742 | 3300005168 | Soil | EQLAREELNMCFPGTRCYIVEGSQPRPGPAQAARQGPAPWYDKLWRSVQQADANPESTAK |
| Ga0066684_109423361 | 3300005179 | Soil | CYIVEGGQPRISPAQAAAKPGPAPWYDKLWRSVQEADGDPAGAAK* |
| Ga0068868_1009135773 | 3300005338 | Miscanthus Rhizosphere | YPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK* |
| Ga0070660_1002563451 | 3300005339 | Corn Rhizosphere | EGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK* |
| Ga0070709_103247843 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADASPAK* |
| Ga0070714_1001730881 | 3300005435 | Agricultural Soil | GTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADASPAK* |
| Ga0070714_1005656603 | 3300005435 | Agricultural Soil | GTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0070713_1007835773 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0070708_1014682792 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EQLARQELDMCFPGTRCYIVEGSQPRVSTAQAAKPGPAPWYDKLWRSVQQADANPESTAR |
| Ga0070706_1001492671 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QELNMCFPGTRCYIVEGGQPRVSTAQAAKAGPAPWYDKLWRSVQQADANPESTAK* |
| Ga0070706_1017166812 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ELNMCFPGTRCYIVEGSQPRPGTAQAAKQGPAPWYDKLWRSVQQADSNPESTAK* |
| Ga0070699_1002857773 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | CYIVEGGQPRASTAQVAKQGPASWYDKLWRSVQQADANPESTAK* |
| Ga0070665_1021625031 | 3300005548 | Switchgrass Rhizosphere | TRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0066706_111318682 | 3300005598 | Soil | PGTRCYIVEGGQPRTSTAQAAKPGPASWYDKLWRSVQQADANPESTAK* |
| Ga0068856_1022664061 | 3300005614 | Corn Rhizosphere | PRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0070702_1000315085 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EQLARQELNMCYPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0068863_1002838653 | 3300005841 | Switchgrass Rhizosphere | CYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0070717_105537711 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LNMCFPGTRCYIVEGGKPPTSTAQAAKRAPASWYDKLWRSVQQADANPESTAK* |
| Ga0070717_113983391 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGRESKAK* |
| Ga0075017_1012141572 | 3300006059 | Watersheds | EGGQPLISTARSPRPGSAPWYDKLWQSVQQADAMPSNPKSAGK* |
| Ga0075017_1014583552 | 3300006059 | Watersheds | LARQELDMCFPGTRCYIVEGSQPRVSMAQAAKPGPAPWYDKLWRSVQQADANPESTAR* |
| Ga0070765_1002997001 | 3300006176 | Soil | GTRCYIVEGGQPRTSTAQAAKPGPASWYDKLWRSVQQADANPGSTAK* |
| Ga0097621_1016897281 | 3300006237 | Miscanthus Rhizosphere | GSQPRVSPAQASEPGPAPWYDKLWRSVQQADASTAK* |
| Ga0079220_103511611 | 3300006806 | Agricultural Soil | LARQELNMCYPGTRCYVVEGSQPRIGTTQAAKAGPAPWYDKLWRSVQQADAGPESPESKAR* |
| Ga0075436_1015136641 | 3300006914 | Populus Rhizosphere | IEQLARQELNMCYPGTRCYVVEGSQPRIGTTQAAKAGPAPWYDKLWRSVQQADAGPESPESKAR* |
| Ga0079219_108426501 | 3300006954 | Agricultural Soil | QLDMCFPRTTCYIVTGGQSPASTARTPRPGPAPWYDKLWRSVQQADASQAK* |
| Ga0079219_108888511 | 3300006954 | Agricultural Soil | ELNMCFPGTRCYIVEGSQPRPGPAQAAKQGPAPWYDKLWRSVQQADADQESTAK* |
| Ga0105247_116349012 | 3300009101 | Switchgrass Rhizosphere | LNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0134086_101980292 | 3300010323 | Grasslands Soil | NMCYPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADTGPESKAK* |
| Ga0126379_115980593 | 3300010366 | Tropical Forest Soil | ASTAQAAKPGPAPWYDKLWRSVQQADANRESAAK* |
| Ga0134125_121230222 | 3300010371 | Terrestrial Soil | LNMCYPGTRCYVVEGSQPRIGTAQAAKVGPASWYDKLWRSVQQADAGPESKAK* |
| Ga0134128_108453033 | 3300010373 | Terrestrial Soil | EGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0134126_107519483 | 3300010396 | Terrestrial Soil | CYPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADASPAK* |
| Ga0134126_118579932 | 3300010396 | Terrestrial Soil | TRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGRESKAK* |
| Ga0134121_127401951 | 3300010401 | Terrestrial Soil | SQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0126359_17160321 | 3300010869 | Boreal Forest Soil | MCFPRTTCYIVTGGQRQAGTAARAAKAGPAPWYDKLWQSVQQADANPKIAAK* |
| Ga0126356_108642931 | 3300010877 | Boreal Forest Soil | TCYIVTGGQRQASTAARAAKAGPAPWYDKLWQSVQQADANPKTPAK* |
| Ga0137382_107681531 | 3300012200 | Vadose Zone Soil | TRCYIVAGGRPRASTAQAAKAGSAPWYDKLWRSVQQADANPESTAK* |
| Ga0137387_105828991 | 3300012349 | Vadose Zone Soil | VEGGQPRAGTAQAAKQGPAPWYDKLWRSVQQADANPESTAK* |
| Ga0137385_113752051 | 3300012359 | Vadose Zone Soil | REELNMCFPGTRCYIVEGGQPRAGTAQAAKQGPAPWYDKLWRSVQQADANPESTAK* |
| Ga0157356_10144611 | 3300012474 | Unplanted Soil | EELNMCFPGTRCYIVEGGHPRASTAQAAKQGPAPWYDKLWRSVQQADANPESTAK* |
| Ga0137419_112758771 | 3300012925 | Vadose Zone Soil | MCFPGTRCYIVEGGQPRAGTAQAAKQGPAPWYDKLWRSVQQADANPESTAK* |
| Ga0164301_104857583 | 3300012960 | Soil | ELNMCYPGTRCYVVEGSQPRIGTVQAAKAGPAPWYDKLWRSVQQADAGPESKAK* |
| Ga0164305_120987581 | 3300012989 | Soil | NMCFPGTRCYIVEGGQRQSGATAQAATPGPAPWYDKLWHSVQQADGSAAR* |
| Ga0182016_107722581 | 3300014493 | Bog | MCFPGTKCYIVEGGQPLVAAAPSSRPGLPSWYDKLWQSVQQADASRAK* |
| Ga0182036_113665821 | 3300016270 | Soil | MCFPGTRCYIVEGSRPQVSPAQAAKAGPAPWYDKLWRSVQQADAGPESAAK |
| Ga0182041_119695132 | 3300016294 | Soil | GSQPRVSPAQAAKSGPAPWYDKLWRSVQQADASTAK |
| Ga0182032_103336623 | 3300016357 | Soil | GDQPQASTAQAAKPGPAPWYDKLWRSVQQADANPESAAK |
| Ga0187809_101753741 | 3300017937 | Freshwater Sediment | IEQLARQELDMCFPGTRCYIVEGSLPSVSLAQAAERGPAPWYDKLWRSVQQADAGPESKA |
| Ga0187785_105300352 | 3300017947 | Tropical Peatland | ELDMCFPGTRCYIAEGSQPRLGPAPVVKAGPAPWYDKLWRSVQQADTGPQSAAK |
| Ga0187767_103632222 | 3300017999 | Tropical Peatland | EGGQPVIGSTHPPRPGPAPWYDKLWRSVQQADANPKIPAK |
| Ga0187885_105097652 | 3300018025 | Peatland | MCFPGTKCYVVEGGQPLAAAAPSSQPGLPPWYDKLWRSVQQADASPAK |
| Ga0210395_103078971 | 3300020582 | Soil | TRCYIVEGGQPRTSTAQAAKPGPASWYDKLWRSVQQADANPESKAK |
| Ga0213881_105758192 | 3300021374 | Exposed Rock | SGQQAPGAARAARPGPAPWYDKLWRSVQQADAGPAR |
| Ga0213876_107661611 | 3300021384 | Plant Roots | GTRCYIVEGSGQQAPGAARAARPGPAPWYDKLWRSVQQADAGPAR |
| Ga0210392_103706871 | 3300021475 | Soil | LDMCFPGTRCYIVEGSQPRVSTAQAAKPGPAPWYDKLWRSVQQADANPESTAR |
| Ga0210392_104345153 | 3300021475 | Soil | MCFPGAKCYIVEGGQPLAGPARSPRPGPAPWYDKLWRSVQQADANPRTPAK |
| Ga0210402_104167381 | 3300021478 | Soil | RTSPAQAAKPGPASWYDKLWRSVQQADANPESTAK |
| Ga0210409_105639063 | 3300021559 | Soil | IVEGSQPRVSTAQAAKPGPAPWYDKLWRSVQQADANPESTAR |
| Ga0210409_107904473 | 3300021559 | Soil | QPRTGTAQAAKPGPASWYDKLWRSVQQADANPESTAK |
| Ga0224564_11120092 | 3300024271 | Soil | TQCYIVEGGQSLISTAQAARRGPAPWYDKLWQSVQQADANPGTSKSPGK |
| Ga0247670_10217733 | 3300024283 | Soil | SQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0179589_101890043 | 3300024288 | Vadose Zone Soil | EQLARQELNMCFPGTRCYIVEGGQPRASAAQAAKQGPAPWYDKLWRSVQQADANPESTAK |
| Ga0179589_102389811 | 3300024288 | Vadose Zone Soil | EGGQPRTSTAQAAKPGSASWYDKLWRSVQQADANPESTAK |
| Ga0207692_103579873 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK |
| Ga0207643_100938121 | 3300025908 | Miscanthus Rhizosphere | ARQELNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0207695_102784603 | 3300025913 | Corn Rhizosphere | LNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK |
| Ga0207700_111540361 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0207704_102357823 | 3300025938 | Miscanthus Rhizosphere | GTRCYIVEGGQPRPSPAQAAKPGPASWYDKLWRSVQQADANPESTPK |
| Ga0207665_100359705 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RQELNMCFPGTRCYVVEGSQPRLSTAQAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0207678_100137742 | 3300026067 | Corn Rhizosphere | MCFPRTTCYIVTGGQTQAGPAARAAKAGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0257153_11041432 | 3300026490 | Soil | GTRCYIVEGGQPRASTAQAAKAGPAPWYDKLWRSVQQADANAESTAK |
| Ga0209577_107782362 | 3300026552 | Soil | PRISPAQAAAKPGPAPWYDKLWRSVQEADGDPAGAAK |
| Ga0209178_12755002 | 3300027725 | Agricultural Soil | YVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADAGPESPESKAR |
| Ga0209074_101931671 | 3300027787 | Agricultural Soil | IEQLARQELNMCFPGTRCYIVEGSQPRPGTAQAAKHGPAPWYDKLWRSVQQADANPESTA |
| Ga0307311_100223021 | 3300028716 | Soil | RQELNMCFPGTRCYIVEGGQPRASTAQAARQGPAPWYDKLWRSVQQADAGPESKAK |
| Ga0302226_101260351 | 3300028801 | Palsa | CFPGTKCYIVEGGQPLVAAAPSSRPGLPSWYDKLWQSVQQADASRAK |
| Ga0302183_101614131 | 3300030509 | Palsa | ARQELDMCFPGTKCYIVEGGQPLVAAAPSSRPGPPSWYDKLWQSVQQADASRAK |
| Ga0311357_113836402 | 3300030524 | Palsa | RQELDMCFPGTKCYIVEGGQPVVAAAPSSRPGLPPWYDKLWRSVQQADASPAK |
| Ga0302326_113450633 | 3300031525 | Palsa | YIVEGRQTSISTARTPKPGPAPWYSKLWQSVQQADASPAK |
| Ga0318555_106742231 | 3300031640 | Soil | CYIVEGSQPRPGPAPAAKTGPAPWYDKLWRSVQQADGGRESMAK |
| Ga0318492_106752411 | 3300031748 | Soil | FPGTQCYIVEGGQPVVSPARPPRPGPAPWYDKLWRSVQQADANPKIPSK |
| Ga0307475_114694151 | 3300031754 | Hardwood Forest Soil | LNMCFPGTRCYIVEGGQPRTGTAQAAKPGPASWYDKLWRSVQQADANPESTAK |
| Ga0318550_106366161 | 3300031797 | Soil | EGSQPQVSPAQPARPGPAPWYDKLWRSVQQADAGPESAAK |
| Ga0318536_104395552 | 3300031893 | Soil | IVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASSASTAK |
| Ga0310912_110206721 | 3300031941 | Soil | CYIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASPASTAK |
| Ga0310916_107204313 | 3300031942 | Soil | EGDQPQASTAQAAKPGPAPWYDKLWRSVQQADANPESAAK |
| Ga0310910_114135611 | 3300031946 | Soil | FPGTRCYIVEGSRPQVSPAQAAKAGPAPWYDKLWRSVQQADASSASTAK |
| Ga0318563_104785802 | 3300032009 | Soil | QLARQELDMCFPGTQCYIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASSASTAK |
| Ga0318513_103658101 | 3300032065 | Soil | LARQELDMCFPGTQCYIVEGSQPQVSPAQPARPGPAPWYDKLWRSVQQADASSASTAK |
| Ga0307472_1016946281 | 3300032205 | Hardwood Forest Soil | AQQELNMCYPGTRCYVVEGSQPRIGTAQAAKAGPAPWYDKLWRSVQQADASPESKAK |
| Ga0306920_1020268113 | 3300032261 | Soil | QVSPAQAAKAGPAPWYDKLWRSVQQADAGPESAAK |
| Ga0335085_100877655 | 3300032770 | Soil | QELDMCLPGTRCYIVEGSQPRPGPAPAVKAGPAPWYDKLWRSVQRADAGRESTAK |
| Ga0335085_117685062 | 3300032770 | Soil | QELDMCLPGTRCYIVEGSQPRPGPAPAAKAGPAPWYDKLWRSVQRADAGRESTAK |
| Ga0335079_117911882 | 3300032783 | Soil | CYIVTGGQPLTSTARTPRPGPAPWYDKLWRSVQQADAAPKSPAK |
| Ga0335080_109185333 | 3300032828 | Soil | QPVIGATHPARPGPAPWYDKLWRSVQRADANPKIPAK |
| Ga0335081_108509541 | 3300032892 | Soil | GGQPVISASDPPRPGPAPWYDKLWRSVQQADANPEIPAK |
| Ga0335069_100829561 | 3300032893 | Soil | IVEGSQPQVSPTQPAKSGPAPWYDKLWRSVQQADASPASTAK |
| Ga0335076_117437382 | 3300032955 | Soil | QQARQELDMCFPGTQCYIVEGGQPVIGSTPAPRPGPAPWYDKLWRSVQQADANPKLPAK |
| ⦗Top⦘ |