| Basic Information | |
|---|---|
| Family ID | F099577 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GDAAPDLDDLVELGTLLAALSESVMAVNSGMMAKARLARGSHT |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.26 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.612 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.388 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02211 | NHase_beta | 17.48 |
| PF01243 | Putative_PNPOx | 8.74 |
| PF13397 | RbpA | 4.85 |
| PF13622 | 4HBT_3 | 4.85 |
| PF10861 | DUF2784 | 3.88 |
| PF02979 | NHase_alpha | 3.88 |
| PF01872 | RibD_C | 3.88 |
| PF07366 | SnoaL | 3.88 |
| PF02518 | HATPase_c | 1.94 |
| PF02861 | Clp_N | 1.94 |
| PF00291 | PALP | 1.94 |
| PF01641 | SelR | 1.94 |
| PF00196 | GerE | 1.94 |
| PF13191 | AAA_16 | 1.94 |
| PF12833 | HTH_18 | 0.97 |
| PF03009 | GDPD | 0.97 |
| PF00743 | FMO-like | 0.97 |
| PF14026 | DUF4242 | 0.97 |
| PF13601 | HTH_34 | 0.97 |
| PF00753 | Lactamase_B | 0.97 |
| PF07077 | DUF1345 | 0.97 |
| PF13384 | HTH_23 | 0.97 |
| PF00248 | Aldo_ket_red | 0.97 |
| PF07969 | Amidohydro_3 | 0.97 |
| PF01169 | UPF0016 | 0.97 |
| PF08031 | BBE | 0.97 |
| PF00005 | ABC_tran | 0.97 |
| PF02551 | Acyl_CoA_thio | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| PF11918 | Peptidase_S41_N | 0.97 |
| PF03551 | PadR | 0.97 |
| PF00795 | CN_hydrolase | 0.97 |
| PF02426 | MIase | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 3.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 3.88 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| COG4829 | Muconolactone delta-isomerase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.97 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.97 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.97 |
| COG1946 | Acyl-CoA thioesterase | Lipid transport and metabolism [I] | 0.97 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.97 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.97 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.97 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.97 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.58 % |
| Unclassified | root | N/A | 19.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01C2BR9 | Not Available | 522 | Open in IMG/M |
| 3300004092|Ga0062389_100496819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1366 | Open in IMG/M |
| 3300004092|Ga0062389_103282784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 606 | Open in IMG/M |
| 3300005339|Ga0070660_100291567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1336 | Open in IMG/M |
| 3300005406|Ga0070703_10289748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300005467|Ga0070706_100489384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1145 | Open in IMG/M |
| 3300005467|Ga0070706_101806808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300005526|Ga0073909_10396704 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005538|Ga0070731_10409109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300005539|Ga0068853_102343690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300005586|Ga0066691_10614387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300005602|Ga0070762_10241682 | Not Available | 1119 | Open in IMG/M |
| 3300005617|Ga0068859_100200073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2082 | Open in IMG/M |
| 3300005718|Ga0068866_10227299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1129 | Open in IMG/M |
| 3300006059|Ga0075017_100940541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. AcE210 | 672 | Open in IMG/M |
| 3300006176|Ga0070765_100890052 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006358|Ga0068871_101920324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300006581|Ga0074048_13507613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 582 | Open in IMG/M |
| 3300006893|Ga0073928_10218967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1477 | Open in IMG/M |
| 3300009098|Ga0105245_12220137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300009545|Ga0105237_10559614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1150 | Open in IMG/M |
| 3300009700|Ga0116217_10441666 | Not Available | 822 | Open in IMG/M |
| 3300010048|Ga0126373_12046215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300010110|Ga0126316_1038803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300010147|Ga0126319_1109471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1021 | Open in IMG/M |
| 3300010341|Ga0074045_10129287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium fluoranthenivorans | 1729 | Open in IMG/M |
| 3300010341|Ga0074045_10351049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
| 3300010358|Ga0126370_10715532 | Not Available | 882 | Open in IMG/M |
| 3300010366|Ga0126379_11236311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300010373|Ga0134128_11803302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300010379|Ga0136449_100907988 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300010397|Ga0134124_11264885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis | 760 | Open in IMG/M |
| 3300010880|Ga0126350_11855308 | Not Available | 704 | Open in IMG/M |
| 3300012209|Ga0137379_11163988 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012407|Ga0134050_1337741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 1022 | Open in IMG/M |
| 3300012469|Ga0150984_119473730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300012481|Ga0157320_1029365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300012501|Ga0157351_1038245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300012882|Ga0157304_1036622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300012901|Ga0157288_10182130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300012929|Ga0137404_11259072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300012957|Ga0164303_10066801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1662 | Open in IMG/M |
| 3300012958|Ga0164299_10618511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300012986|Ga0164304_10272071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
| 3300013105|Ga0157369_11590833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300013297|Ga0157378_10640522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1078 | Open in IMG/M |
| 3300015371|Ga0132258_11077486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2031 | Open in IMG/M |
| 3300016404|Ga0182037_10454196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1066 | Open in IMG/M |
| 3300017948|Ga0187847_10197053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1098 | Open in IMG/M |
| 3300018062|Ga0187784_11107705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300018482|Ga0066669_10674299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300020579|Ga0210407_10934400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus macrosporus → Corallococcus macrosporus DSM 14697 | 664 | Open in IMG/M |
| 3300021377|Ga0213874_10378927 | Not Available | 547 | Open in IMG/M |
| 3300021407|Ga0210383_11014043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 704 | Open in IMG/M |
| 3300021474|Ga0210390_10068518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2932 | Open in IMG/M |
| 3300021479|Ga0210410_11425609 | Not Available | 585 | Open in IMG/M |
| 3300021559|Ga0210409_10894842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300024219|Ga0247665_1036499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300025911|Ga0207654_10214808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
| 3300027825|Ga0209039_10018393 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
| 3300027857|Ga0209166_10213219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces europaeiscabiei | 1035 | Open in IMG/M |
| 3300027915|Ga0209069_10907879 | All Organisms → cellular organisms → Archaea | 534 | Open in IMG/M |
| 3300028146|Ga0247682_1027511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 1006 | Open in IMG/M |
| 3300028780|Ga0302225_10130593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1221 | Open in IMG/M |
| 3300028879|Ga0302229_10005447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8463 | Open in IMG/M |
| 3300028879|Ga0302229_10539030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300028906|Ga0308309_11687499 | Not Available | 538 | Open in IMG/M |
| 3300029943|Ga0311340_10346680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1389 | Open in IMG/M |
| 3300029943|Ga0311340_11572608 | Not Available | 512 | Open in IMG/M |
| 3300029999|Ga0311339_10258071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1911 | Open in IMG/M |
| 3300030007|Ga0311338_12029230 | Not Available | 510 | Open in IMG/M |
| 3300030490|Ga0302184_10128515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300030524|Ga0311357_10005383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14312 | Open in IMG/M |
| 3300030629|Ga0210268_1363963 | Not Available | 505 | Open in IMG/M |
| 3300031233|Ga0302307_10223397 | Not Available | 969 | Open in IMG/M |
| 3300031474|Ga0170818_103082674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300031546|Ga0318538_10747787 | Not Available | 530 | Open in IMG/M |
| 3300031572|Ga0318515_10644637 | Not Available | 562 | Open in IMG/M |
| 3300031680|Ga0318574_10679597 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031765|Ga0318554_10829584 | Not Available | 516 | Open in IMG/M |
| 3300031771|Ga0318546_10435998 | Not Available | 917 | Open in IMG/M |
| 3300031781|Ga0318547_10565131 | Not Available | 704 | Open in IMG/M |
| 3300031781|Ga0318547_10888195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 556 | Open in IMG/M |
| 3300031897|Ga0318520_10684350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300031910|Ga0306923_11897955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 608 | Open in IMG/M |
| 3300031912|Ga0306921_10149081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2736 | Open in IMG/M |
| 3300031912|Ga0306921_12104080 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032008|Ga0318562_10527769 | Not Available | 684 | Open in IMG/M |
| 3300032035|Ga0310911_10713548 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032043|Ga0318556_10121905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| 3300032044|Ga0318558_10352411 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300032063|Ga0318504_10024825 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300032065|Ga0318513_10305113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300032066|Ga0318514_10498264 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032090|Ga0318518_10023458 | Not Available | 2749 | Open in IMG/M |
| 3300032174|Ga0307470_10417164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300032205|Ga0307472_102455664 | Not Available | 529 | Open in IMG/M |
| 3300032261|Ga0306920_101820681 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032828|Ga0335080_11943802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300032828|Ga0335080_12170470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300033004|Ga0335084_11735526 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300033134|Ga0335073_10583838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1253 | Open in IMG/M |
| 3300033158|Ga0335077_12137892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.97% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_01723750 | 2170459024 | Grass Soil | ALNAAREAQHRLDNGNATPDLDDLVELGTLLAALSESAMAVNSAMMAKARLAQRSHT |
| Ga0062389_1004968191 | 3300004092 | Bog Forest Soil | TPDLDDLVELGTLLAGLSESVMAVNSEMIAKARLAREANK* |
| Ga0062389_1032827841 | 3300004092 | Bog Forest Soil | HHLDDGNATPDLDDLVELSTLLAGLSEAVSAVNSGMTEKARLAKG* |
| Ga0070660_1002915674 | 3300005339 | Corn Rhizosphere | FDNGDATPDLDDLVELSTLLAGLSESITAVNSGMIAKARLARGSHT* |
| Ga0070703_102897482 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DNGDATPDLDDLVELATLLAGLSESVTAVNSGMIAKARLARGSHT* |
| Ga0070706_1004893843 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FDNGDATPDLDDLVELGKLVAGLSEAVTAVNAEMMEKARLARGSNA* |
| Ga0070706_1018068081 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QHRLDDGNAAPDLDDLVELGTLLAALSESVMAVNSGMMAKARLAQGSHT* |
| Ga0073909_103967042 | 3300005526 | Surface Soil | ATREAQHRFDNGDATPDLDDLVELSTLLAGLSESVTAVNSGMIAKARLARGSHT* |
| Ga0070731_104091093 | 3300005538 | Surface Soil | HHLDGGDAAPDLDDLVELGKLVSALSESVMAVNSGMLAKAHQAQGAGA* |
| Ga0068853_1023436902 | 3300005539 | Corn Rhizosphere | TPDLDDLVELGKLVAALSEAVTAVNAEMMEKARLARGSNA* |
| Ga0066691_106143871 | 3300005586 | Soil | DATPDLDDLVELGKLVAALSEAVTAVNAEMMEKARLARGSNA* |
| Ga0070762_102416822 | 3300005602 | Soil | HRLDDGDATPDLDDLVELGKLVAGLAESVTAVNSGMLAKARLAQDANT* |
| Ga0068859_1002000731 | 3300005617 | Switchgrass Rhizosphere | REAQHRLDNGDATPDLDDLVELSTLLAGLSESVTAVNSGMIAKARLARGSHT* |
| Ga0068866_102272991 | 3300005718 | Miscanthus Rhizosphere | LVELSTLLAGLSESVTAVNSGMIAKARLARGSHT* |
| Ga0075017_1009405411 | 3300006059 | Watersheds | GNAAPDLDDLVELGTLLAALSESAMAVNSAMMAKARLARGSHT* |
| Ga0070765_1008900521 | 3300006176 | Soil | EALNSAREARHRLEDGDATPDLDDLVELGTLLAGLSESLSAVNSGMLAKARLAQNANT* |
| Ga0068871_1019203241 | 3300006358 | Miscanthus Rhizosphere | RHHLDDGDATPDLDDLVELGKLVAALSEAVTAVNAEMMEKARLARGSNA* |
| Ga0074048_135076131 | 3300006581 | Soil | APDLDDLVELGTLLAALSESVMAVNSGMMAKARAARGSHT* |
| Ga0073928_102189671 | 3300006893 | Iron-Sulfur Acid Spring | AREAQHRLENGDATPDLDDLVELGKLLAGLSEAAMTVNSGMLAQARLAREANA* |
| Ga0105245_122201371 | 3300009098 | Miscanthus Rhizosphere | PDLDDLVELATLLAGLSESVTAVNSGMIAKARVARGSHT* |
| Ga0105237_105596141 | 3300009545 | Corn Rhizosphere | HRFDNGDATPDLDDLVELSALLAGLSESITAVNSGMIAKARLARGSHT* |
| Ga0116217_104416662 | 3300009700 | Peatlands Soil | RHRLDDGNAAPDLDDLVELGTLLAALSESVMAVNSVMMAKARLARGSNT* |
| Ga0126373_120462151 | 3300010048 | Tropical Forest Soil | APDPDDLVELGTLLAALSESVMAVNSGMMEKARLARGSSA* |
| Ga0126316_10388032 | 3300010110 | Soil | GEAQHRLDNGDATPDLDDLVELATLLAGLSESVAAVNSGMIAKARAARGSHT* |
| Ga0126319_11094711 | 3300010147 | Soil | PDLDDLVELATLLAGLSESVTAVNSGMIAKARAARGSHT* |
| Ga0074045_101292872 | 3300010341 | Bog Forest Soil | EARHRLDDGNAAPDLDDLVELGTLLAALSESVMAVNSVMMAKARLARGSNI* |
| Ga0074045_103510491 | 3300010341 | Bog Forest Soil | AREARHRLDDGNAAPDLDDLVELGTLLAGLSESVMAVNSGMMAKARLARGSNA* |
| Ga0126370_107155321 | 3300010358 | Tropical Forest Soil | NSARQARQRLDDGDAAPDLDDLVELGTLLAALSESVMAVNSEMMTQARLARGSNT* |
| Ga0126379_112363112 | 3300010366 | Tropical Forest Soil | QHLDDGDAAPYLDDLVELSTLLAGLSESVMAVNSGMMAKARLARGSST* |
| Ga0134128_118033023 | 3300010373 | Terrestrial Soil | DNGDATPDLDDLVELSTLLAGLSESVTAVNSGMIAKARLARGSHT* |
| Ga0136449_1009079883 | 3300010379 | Peatlands Soil | LDDGEATPDLDDLVELGKLLAALSESAAAINVGMTTKARLARGSTT* |
| Ga0134124_112648852 | 3300010397 | Terrestrial Soil | DLVELGKLLAGLSEAVMAVNAGMTEKARLARGSNA* |
| Ga0126350_118553081 | 3300010880 | Boreal Forest Soil | ATPDLDDLVELGTLLAGLSEALTAVNSGMLAKARAAQD* |
| Ga0137379_111639881 | 3300012209 | Vadose Zone Soil | ARHRLDDGNAAPDLDDLVELGTLLAALSEAVMAVNSVMMTKARLARGSNT* |
| Ga0134050_13377411 | 3300012407 | Grasslands Soil | EAQHRLDDGNAAPDLDDLVELGTLLAGLSESVMAVNSGMMAKARTAQGSHT* |
| Ga0150984_1194737302 | 3300012469 | Avena Fatua Rhizosphere | DDLVELATLLAGLSESVAAVNSGMIAKAHAARGSHT* |
| Ga0157320_10293652 | 3300012481 | Arabidopsis Rhizosphere | DDLVELSTLLAGLSESVTAVNSGMIAKAHAAQGSHT* |
| Ga0157351_10382452 | 3300012501 | Unplanted Soil | DLDDLVELATLLAGLSESVTAVNSGMIAKAHAAQGSHT* |
| Ga0157304_10366223 | 3300012882 | Soil | EALIAAREAQHRLDNGDATPDLDDLVELATLLAGLSESVAAVNSGMIAKARAARGSHT* |
| Ga0157288_101821301 | 3300012901 | Soil | PDLDDLVELATLLAGLSESVMAVNSGMIAKARAARGSLT* |
| Ga0137404_112590721 | 3300012929 | Vadose Zone Soil | DDLVELGKLVAALSEAVTAVNAEMMEKARLARGSNA* |
| Ga0164303_100668014 | 3300012957 | Soil | AQHRLDNGDATPDLDDLVELSTLLAGLSESVTAVNSGMIAKARLARGSHT* |
| Ga0164299_106185112 | 3300012958 | Soil | LHEALNSAREARHHLDDGDATPDLDDLVELGKLVAALSEAVTAVNAEMMEKARLARGSNA |
| Ga0164304_102720713 | 3300012986 | Soil | AAREAGHRLDDGDAAPDLDDLVELGTLLAALAESVMGINATMMARARLAQGSRT* |
| Ga0157369_115908331 | 3300013105 | Corn Rhizosphere | DATPDLDDLVELSTLLAGLSESVTAVNSGMIAKARLARGSNA* |
| Ga0157378_106405221 | 3300013297 | Miscanthus Rhizosphere | HEALIATREAQHRFDNGDATPDLDDLVELSTLLAGLSESVAAVNSGMIAKARLARGSHT* |
| Ga0132258_110774864 | 3300015371 | Arabidopsis Rhizosphere | QHRLDDGEATPDLDDLVELGTLLAALSESVMAVNSGMMEKARLARGSHT* |
| Ga0182037_104541961 | 3300016404 | Soil | DGDAAPDLDDLVELSTLLAALSESIMAVNSTMMAKARLARGSST |
| Ga0187847_101970533 | 3300017948 | Peatland | LDDGDAAPDLDDLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0187784_111077051 | 3300018062 | Tropical Peatland | ALHEAVNATREARQRLDDGDATPDSDDLVELSKLLAELSESAMAVNLGMMAKARLARG |
| Ga0066669_106742992 | 3300018482 | Grasslands Soil | HHLQDGDAGPDLDDLVELGKLVVALSESVTAVNAEMIAKARQARDGSPA |
| Ga0210407_109344002 | 3300020579 | Soil | HRLEDGDATPDLDDLVELGKLLAGLSEAAMAVNSEMIAKARLAQDADT |
| Ga0213874_103789272 | 3300021377 | Plant Roots | GQAAPDLDDLVELGTLLAALSESVMAVNSGMMAKARTARGSHA |
| Ga0210383_110140431 | 3300021407 | Soil | GDATPDLDDLVELGTLLAGLSESLSAVNSGMLAKARLAQNANT |
| Ga0210390_100685185 | 3300021474 | Soil | DLDDLVELGKLLAGLSESIMAVNSGMMAKARLAREANA |
| Ga0210410_114256091 | 3300021479 | Soil | DDLVELGKLVAGLAESVTAVNSGMLAKARLAQDANT |
| Ga0210409_108948422 | 3300021559 | Soil | SAREAQHHLDDGDAAPDLDDLVELGKLLAGLSESVMAINSEMMEKARLARSSNT |
| Ga0247665_10364991 | 3300024219 | Soil | AQHRFDNGDATPDLDDLVELSTLLAGLSESITAVNSGMIAKARLARGSHT |
| Ga0207654_102148081 | 3300025911 | Corn Rhizosphere | QHRLDNGDATPDLDDLVELSTLLAGLSESVTAVNSGMIAKARLARGSHT |
| Ga0209039_100183931 | 3300027825 | Bog Forest Soil | EARHRLDDGNAAPDLDDLVELGTLLAALSESVMAVNSVMMAKARLARGSNT |
| Ga0209166_102132193 | 3300027857 | Surface Soil | FGEEARHRLEDGDATPDLDDLVELGTLLAGLSEAVTAVNSGMLAKARQASK |
| Ga0209069_109078791 | 3300027915 | Watersheds | NSAREAQHRLDEGDAAPDLDDLVELGTLLAGLSESVMAVNSGMMAKARLARGSHT |
| Ga0247682_10275111 | 3300028146 | Soil | ATPDLDDLVELSTLLAGLSESITAVNSGMIAKARLARGSHT |
| Ga0302225_101305933 | 3300028780 | Palsa | DLDDLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0302229_100054478 | 3300028879 | Palsa | APDLDDLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0302229_105390301 | 3300028879 | Palsa | ATPDLDDLVELGKLLAGLTEVITAVNSEMLAKASLAQNANT |
| Ga0308309_116874992 | 3300028906 | Soil | HRLDDGDATPDLDDLVELGTLLAGLSEAVVAVNSGMLAKARLAQGSHT |
| Ga0311340_103466801 | 3300029943 | Palsa | HRLDDGDAAPDLDDLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0311340_115726083 | 3300029943 | Palsa | PDLDDLVELSTLLAGLSESIAAVNSGMAEKARQAKG |
| Ga0311339_102580711 | 3300029999 | Palsa | PDLDDLVELGTLLAGLSESLAAVNSEMLAKARLAQKANT |
| Ga0311338_120292302 | 3300030007 | Palsa | VNSAREARHHLEGGDATPDLDDLVELGKLLAELSESVIAVNSEMLAKARDAKA |
| Ga0302184_101285153 | 3300030490 | Palsa | LDDLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0311357_1000538318 | 3300030524 | Palsa | YLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0210268_13639631 | 3300030629 | Soil | NDDLVELGKLLAALSESAMAVNLGMMAKARLARGSDT |
| Ga0302307_102233971 | 3300031233 | Palsa | PDLDDLVELGTLLAGLSESLTAVNSGMLAKARLAQGSHT |
| Ga0170818_1030826742 | 3300031474 | Forest Soil | AREARHHLDDGDAAPDLDDLVELGKLVAALSESVTAVNSEMMEKARLAQGSKT |
| Ga0318538_107477871 | 3300031546 | Soil | REARHHLDDGDATPDLDDLVELSTLLTALSESVMAVNSGMIAKARLARGSHT |
| Ga0318515_106446371 | 3300031572 | Soil | LNSAREARQRLDDGDATPDLDDLAELGRLLAALSESVMAVNSGMAAKARLAHGSNA |
| Ga0318574_106795972 | 3300031680 | Soil | DEGDATPDLDDLVELSKLLAGLSESVMAVNSGMIEKARLARGSHT |
| Ga0318554_108295841 | 3300031765 | Soil | DDGDATPDLDDLVELSTLLTALSESVMAVNSGMIAKARLARGSHT |
| Ga0318546_104359983 | 3300031771 | Soil | NSAREARHHLEDGDATPDLDDLVELGRLLAALSESVMAVNSGMIAKARLARGSHT |
| Ga0318547_105651311 | 3300031781 | Soil | GDATPDLDDLVELSTLLTALSESVMAVNSGMIAKARLARGSHT |
| Ga0318547_108881951 | 3300031781 | Soil | RVEDGDAAPDLDDLVELGTLLAALSESIMAVNSAMMAKARLARGSST |
| Ga0318520_106843501 | 3300031897 | Soil | LDEGDAAPDLDDLVELGTLLAALSESVMAVNSGMMAKARLARGSSA |
| Ga0306923_118979551 | 3300031910 | Soil | DAAPDLDDLVELGTLLAALSESIMAVNSAMMAKARLARGSSS |
| Ga0306921_101490811 | 3300031912 | Soil | DAAPDLDDLVELSTLLAALSESIMAVNSTMMAKARLARGSST |
| Ga0306921_121040801 | 3300031912 | Soil | PDLDDLVELGTLLAALSESVMAVNSGMMAKARLARGSHT |
| Ga0318562_105277691 | 3300032008 | Soil | AQHRLDDGDAAPDLDDLVELGTLLAALSESVMAVNSGMMAKARLARGSHA |
| Ga0310911_107135481 | 3300032035 | Soil | DGDATPDLDDLVELSKLLAGLSESVMAVNSGMIEKARLARGSHT |
| Ga0318556_101219053 | 3300032043 | Soil | DLDDLVELSTLLAALSESIMAVNSTMMAKARLARGSST |
| Ga0318558_103524111 | 3300032044 | Soil | HEALNSAREAQHHLDDGDATPDLDDLVELGTLLAALSESVMAVNSGMMAKARLARGSHT |
| Ga0318504_100248253 | 3300032063 | Soil | ATPDLDDLVELSKLLAGLSESVMAVNSGMIEKARLAQGSHT |
| Ga0318513_103051132 | 3300032065 | Soil | HEAVNSAREARQRLDDGDAAPDLDDLVALGNLLAALSESVMAINSGMAAKARLAHGSNA |
| Ga0318514_104982642 | 3300032066 | Soil | LNSAREAKHHFDEGDATPDLDDLVELSKLLAGLSESVMAVNSGMIEKARLARGSHT |
| Ga0318518_100234582 | 3300032090 | Soil | HEALNSARQARQRLDDGDAAPDLDDLVELGTLLAALSESVMAINSGMAAKARLAHGSNA |
| Ga0307470_104171643 | 3300032174 | Hardwood Forest Soil | DNGDPTPDLDDLVELATLLAGLSESVTAVNSGMIAKARVARGSHT |
| Ga0307472_1024556641 | 3300032205 | Hardwood Forest Soil | IAAREAQHRLDDGNAAPDLDDLVELGTLLAGLSESVMAVNSGMMAKARLARGSHT |
| Ga0306920_1018206811 | 3300032261 | Soil | EALNSAREAKHHFDEGDATPDLDDLVELSKLLAGLSESVMAVNSGMIEKARLARGSHT |
| Ga0335080_119438021 | 3300032828 | Soil | LDDLVELATLLAGLSESVTAVNSGMIAKARLARGSHT |
| Ga0335080_121704701 | 3300032828 | Soil | HHLDDGDAAPDLDDLMELGKLLAGLSEAVMAVNAGMTEKARLARGSNA |
| Ga0335084_117355261 | 3300033004 | Soil | GDAAPDLDDLVELGTLLAALSESVMAVNSGMMAKARLARGSHT |
| Ga0335073_105838381 | 3300033134 | Soil | PDLDDLVELATLLAALSESVMAVNSGMMTKARLARGSST |
| Ga0335077_121378922 | 3300033158 | Soil | LDDLVELGTLLAGLSDAVMAVNSGMTTKARAARGSHT |
| ⦗Top⦘ |