NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099556

Metagenome Family F099556

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099556
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 49 residues
Representative Sequence DKLKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKAL
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 97.09 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.117 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.738 % of family members)
Environment Ontology (ENVO) Unclassified
(38.835 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.194 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.48%    β-sheet: 12.99%    Coil/Unstructured: 67.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF01408GFO_IDH_MocA 16.50
PF09335SNARE_assoc 12.62
PF02894GFO_IDH_MocA_C 11.65
PF12704MacB_PCD 4.85
PF13620CarboxypepD_reg 1.94
PF07690MFS_1 1.94
PF13561adh_short_C2 1.94
PF12833HTH_18 1.94
PF09413DUF2007 1.94
PF09594GT87 0.97
PF13366PDDEXK_3 0.97
PF13533Biotin_lipoyl_2 0.97
PF05227CHASE3 0.97
PF04203Sortase 0.97
PF00892EamA 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 12.62
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 12.62
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 12.62
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 11.65
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.12 %
UnclassifiedrootN/A3.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002JHQODNot Available511Open in IMG/M
3300000891|JGI10214J12806_12393071All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300000956|JGI10216J12902_112273005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371036Open in IMG/M
3300001686|C688J18823_11044183All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300004081|Ga0063454_101434528All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300004114|Ga0062593_100590600All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300004463|Ga0063356_101683856All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300004463|Ga0063356_103562280All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300004463|Ga0063356_105214543All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005093|Ga0062594_102921341All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005334|Ga0068869_101098303All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300005336|Ga0070680_101699383All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005343|Ga0070687_101508896All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300005354|Ga0070675_100184917All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300005440|Ga0070705_100420490All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300005458|Ga0070681_10672210All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300005468|Ga0070707_101556541Not Available628Open in IMG/M
3300005539|Ga0068853_101805002All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005544|Ga0070686_100340335All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300005546|Ga0070696_100108124All Organisms → cellular organisms → Bacteria2000Open in IMG/M
3300005546|Ga0070696_101225158All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005548|Ga0070665_100303073All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300005576|Ga0066708_10846006All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005719|Ga0068861_101292605All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300005843|Ga0068860_100754674Not Available985Open in IMG/M
3300005875|Ga0075293_1071934All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006177|Ga0075362_10615005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes562Open in IMG/M
3300006237|Ga0097621_100761538All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300006237|Ga0097621_101385452All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300006755|Ga0079222_12127430All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300006844|Ga0075428_102036248All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006871|Ga0075434_101898198All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300006871|Ga0075434_102013144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes583Open in IMG/M
3300006880|Ga0075429_101861135All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300006881|Ga0068865_100658523All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300009093|Ga0105240_10349967All Organisms → cellular organisms → Bacteria → Proteobacteria1676Open in IMG/M
3300009094|Ga0111539_10139027All Organisms → cellular organisms → Bacteria2844Open in IMG/M
3300009098|Ga0105245_12888389All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300009101|Ga0105247_10420435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37957Open in IMG/M
3300009156|Ga0111538_11050181All Organisms → cellular organisms → Bacteria → Acidobacteria1030Open in IMG/M
3300009156|Ga0111538_12311810All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300009156|Ga0111538_14030615All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300009174|Ga0105241_11967816All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009177|Ga0105248_13071453All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300009545|Ga0105237_11006682All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300009545|Ga0105237_12548683All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Snodgrassella → unclassified Snodgrassella → Snodgrassella sp. CFCC 13594522Open in IMG/M
3300009789|Ga0126307_10788066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37767Open in IMG/M
3300010401|Ga0134121_11010430All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300011422|Ga0137425_1166818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37549Open in IMG/M
3300012910|Ga0157308_10354281All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012951|Ga0164300_10432460All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300012960|Ga0164301_11240833All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300012971|Ga0126369_13325711All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012986|Ga0164304_10156854All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300012989|Ga0164305_11808889All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300013306|Ga0163162_10604011All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300014325|Ga0163163_10462186All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300014745|Ga0157377_11560113All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300014861|Ga0180061_1076968All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300015077|Ga0173483_10101860All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300015258|Ga0180093_1090570All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300015371|Ga0132258_11510880All Organisms → cellular organisms → Bacteria1696Open in IMG/M
3300015371|Ga0132258_12551578All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300015372|Ga0132256_100005794All Organisms → cellular organisms → Bacteria → Acidobacteria10595Open in IMG/M
3300015372|Ga0132256_100446427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-371400Open in IMG/M
3300015373|Ga0132257_100141954All Organisms → cellular organisms → Bacteria → Acidobacteria2807Open in IMG/M
3300015373|Ga0132257_100489921All Organisms → cellular organisms → Bacteria → Acidobacteria1506Open in IMG/M
3300015373|Ga0132257_100651421All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300015374|Ga0132255_104555745All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300016294|Ga0182041_10620713All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300016371|Ga0182034_11095063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria690Open in IMG/M
3300018067|Ga0184611_1027450All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300018481|Ga0190271_10092784All Organisms → cellular organisms → Bacteria2753Open in IMG/M
3300018482|Ga0066669_11987997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37544Open in IMG/M
3300025290|Ga0207673_1018012All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis945Open in IMG/M
3300025907|Ga0207645_11169556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37517Open in IMG/M
3300025913|Ga0207695_10345578All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300025920|Ga0207649_10898518All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300025920|Ga0207649_11338898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37566Open in IMG/M
3300025926|Ga0207659_10791033All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium815Open in IMG/M
3300025934|Ga0207686_10372009All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300025937|Ga0207669_11309823All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300025960|Ga0207651_12048412All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300025981|Ga0207640_11986917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37527Open in IMG/M
3300026095|Ga0207676_12032189All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300028379|Ga0268266_11294712All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300028380|Ga0268265_10541545All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300028754|Ga0307297_10299153All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300031455|Ga0307505_10442954All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300031562|Ga0310886_10404533All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300031679|Ga0318561_10508500All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300031858|Ga0310892_11043640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37578Open in IMG/M
3300031902|Ga0302322_102062732All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300031938|Ga0308175_102689375All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031944|Ga0310884_11022033All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300031949|Ga0214473_11906583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37583Open in IMG/M
3300032002|Ga0307416_100533194All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300032003|Ga0310897_10197477All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300032005|Ga0307411_11220466All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300032180|Ga0307471_103803708All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300034149|Ga0364929_0267560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCN 69-37578Open in IMG/M
3300034155|Ga0370498_156577All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.97%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.97%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.97%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.97%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.97%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_069042202170459003Grass SoilAKNRKTNAPMEIGYNSALPALLALEAMKTNKVLGWDPVARKSKAI
JGI10214J12806_1239307123300000891SoilAKNRKTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKSKAL*
JGI10216J12902_11227300513300000956SoilNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARQSKAL*
C688J18823_1104418323300001686SoilHVHTRDFLDKLKAKNRATNAPLEIGYNSALPCLLALEAMQQNRVLGWDASARKSKAL*
Ga0063454_10143452823300004081SoilKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDPAARKSKAL*
Ga0062593_10059060023300004114SoilKLKAKNRKTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKSKAL*
Ga0063356_10168385613300004463Arabidopsis Thaliana RhizosphereTNASMEIGYNSALPALLALDAMKTNKVLGWDPVAKKSTVI*
Ga0063356_10356228023300004463Arabidopsis Thaliana RhizosphereNAPMEVGYNSALPALLALEAMKDNKVLGWDPAARKSKVL*
Ga0063356_10521454313300004463Arabidopsis Thaliana RhizospherePLHVHTRDFLDKLKAKDRNTNASMEIGYNSALPALLALEAMKQNKVLGWDPVARASKVL*
Ga0062594_10292134123300005093SoilTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKTKVI*
Ga0068869_10109830323300005334Miscanthus RhizosphereKLKTKNRATNASLEVGYNSALPCLLALEAMQQNRVLGWDAAARKSKAL*
Ga0070680_10169938313300005336Corn RhizosphereAHTRDFLDKMKAKNRKTSAPMDIGYNSALPALLALEAMQQNRVLGWDAAERKSKTL*
Ga0070687_10150889623300005343Switchgrass RhizosphereRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMKDNKVLGWDPVARKSKVV*
Ga0070675_10018491733300005354Miscanthus RhizosphereRDFLDKLKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKTKAL*
Ga0070705_10042049013300005440Corn, Switchgrass And Miscanthus RhizosphereHTRDFLDKLKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKAI*
Ga0070681_1067221023300005458Corn RhizosphereTSAPMDIGYNSALPALLALEAMQQNRVLGWDAAERKSKTL*
Ga0070707_10155654113300005468Corn, Switchgrass And Miscanthus RhizosphereTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVAKKSKAI*
Ga0068853_10180500213300005539Corn RhizosphereLHAHTRDFLDKLKAKNRKTNAPMDVGYNSALPALLALEAMKENKVLAWDPAARKSKVV*
Ga0070686_10034033523300005544Switchgrass RhizosphereDKLKAKNRATNAPLEVGYNSALPCLLALEAMQQNRVLGWDAKGRKSTAL*
Ga0070696_10010812413300005546Corn, Switchgrass And Miscanthus RhizosphereRKTNAPMEIGYNSALPALLALEAMKDNKVLGWDPVARKSKAI*
Ga0070696_10122515823300005546Corn, Switchgrass And Miscanthus RhizosphereRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKSKAL*
Ga0070665_10030307313300005548Switchgrass RhizosphereRKKPNAPMEIGYNSALPCLLALEAMQKGRVMGWDPATKSTKVL*
Ga0066708_1084600623300005576SoilKAKNRATNAPLEVGYNSALPCLLALEAMQQNRVLGWDATARKSKAL*
Ga0068861_10129260513300005719Switchgrass RhizosphereRKTNAPMEVGYNSALPALLALEAIKDNKVLGWDPVARKSKAI*
Ga0068860_10075467423300005843Switchgrass RhizosphereNRKTNAPMEVGYNSALPALLALEAMKENKILGWDPVARRSKAI*
Ga0075293_107193413300005875Rice Paddy SoilTNAPMDIGYNSALPALLALEAMKENKVLGWDPVARKSKAI*
Ga0075362_1061500513300006177Populus EndosphereDFLDKLKAKNRATNAPLEVGYNSALPCLLALEAMQQNRVLGWDAKARKSTAL*
Ga0097621_10076153813300006237Miscanthus RhizosphereDFLDKMKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDATARKSKAI*
Ga0097621_10138545213300006237Miscanthus RhizosphereRNFLDCLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARTSKAL*
Ga0079222_1212743013300006755Agricultural SoilTRDFLDKLKAKNRKTNAPMEIGYNSALPCLLALEAMQQNKVLGWDAAARKSKTL*
Ga0075428_10203624823300006844Populus RhizosphereTRDFLDKLKAKNRKTNASMEVGYNSALPALLALEAMKENKVLGWDPAARKVI*
Ga0075434_10189819823300006871Populus RhizospherePLHAHTRDFLDKLKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKTKAI*
Ga0075434_10201314423300006871Populus RhizosphereHVHTRDFLDKLKAKNRATNAPLEVGYNSALPCLLALEAMKQNRVIGWDAGGRKSTTV*
Ga0075429_10186113513300006880Populus RhizosphereLKAKDRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPAARKSKAL*
Ga0068865_10065852323300006881Miscanthus RhizosphereNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKAI*
Ga0105240_1034996713300009093Corn RhizosphereRATNAPLNIGYNSALPCVLALEAMRENKVLGWDAAARKSKAL*
Ga0111539_1013902763300009094Populus RhizosphereRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMKDNKVLGWDPVARKSKAI*
Ga0105245_1288838923300009098Miscanthus RhizosphereLDKLKAKDRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDATARKSKAI*
Ga0105247_1042043513300009101Switchgrass RhizosphereKAKNRKTNASMDVGYNSALPALLALEAMKENKVLGWDPVARRSKVL*
Ga0111538_1105018113300009156Populus RhizosphereKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKVI*
Ga0111538_1231181013300009156Populus RhizosphereDFLDKLKVRNRKTNASMEIGYNSALPALLALEAMKTNKVLGWDPVAKKSTVI*
Ga0111538_1403061513300009156Populus RhizosphereNRKTNAPMEVGYNSALPALLALEAMKENKVLGWDPVARKTKAL*
Ga0105241_1196781613300009174Corn RhizosphereEIGYNSALPALLALEAMKDTKVLGWDPVARKSKAI*
Ga0105248_1307145323300009177Switchgrass RhizosphereLHVHTRDFLDKLKAKNRKTNAPMEVGYNSALPALLALEAMKENKILGWDPVARRSKAI*
Ga0105237_1100668213300009545Corn RhizosphereKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKTKAI*
Ga0105237_1254868323300009545Corn RhizosphereFLDCVKSRNRQTNASMEIGYNSALPCLLALEAMQQNRVLGWDPVAKKAKVL*
Ga0126307_1078806623300009789Serpentine SoilVGYNSALPALLALEAMKENKVLDWDPVARKSKVL*
Ga0134121_1101043013300010401Terrestrial SoilKTAAPMEVGYNSALPALLALEAMKDNKILGWDPVAKKSKVL*
Ga0137425_116681823300011422SoilLKAKNRKTNAPMEVGYNSALPALLALEAMRENKVLGWDPVARKSKVL*
Ga0137375_1141732613300012360Vadose Zone SoilLEVGYNSALPCLLALEAMKQKRVIGWDPVARKPRVF*
Ga0157308_1035428123300012910SoilEVGYNSALPALLALEAMKDNKVLGWDPVARTSKVI*
Ga0164300_1043246013300012951SoilKTNAPMEVGYNSALPALLALEAMKDNKVLGWDATARKSKAI*
Ga0164301_1124083313300012960SoilRDFLDKLKAKNRATNAPLEVGYNSALPCLLALEAMKDGKVLGWDAKARKSVVL*
Ga0126369_1332571123300012971Tropical Forest SoilDFLDKLKAKNRATNAPLEVGYNSALPCLLALEAMQQNRILGWDANARKSTVL*
Ga0164304_1015685413300012986SoilPLHAHTRDFLDKLKAKNRKTNAPMDVGYNSALPALLALEAMKDNKVLGWDPVARKSKVV*
Ga0164305_1180888913300012989SoilVHTRNFLDCLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARTSKAL*
Ga0163162_1060401123300013306Switchgrass RhizosphereYPLHAHTRDFLDKMKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDATARKSKAI
Ga0163163_1046218613300014325Switchgrass RhizosphereKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPAARKSKVL*
Ga0157377_1156011313300014745Miscanthus RhizosphereTRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKTKVI*
Ga0180061_107696813300014861SoilPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKVL*
Ga0173483_1010186013300015077SoilRDFLDKLKAKDRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPAARKSKVL*
Ga0180093_109057033300015258SoilDFVDKLKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVAKKSKAL*
Ga0132258_1151088013300015371Arabidopsis RhizosphereLHVHTRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKSKAL*
Ga0132258_1255157813300015371Arabidopsis RhizosphereKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKAV*
Ga0132256_100005794113300015372Arabidopsis RhizospherePLHVHTRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMQQNKVLGWDAAARKSKAL*
Ga0132256_10044642713300015372Arabidopsis RhizosphereLKAKNRKTNAPMDVGYNSALPALLALDAMKENKILGWDPAAKKSKVL*
Ga0132257_10014195453300015373Arabidopsis RhizosphereYPLHAHTRDFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMKDNKVLGWDATARKSKAI
Ga0132257_10048992133300015373Arabidopsis RhizosphereVHTRNFLDCLKAKNRKTAAPMEIGYNSALPCLLALEAMQQNRVLGWDAAAHKSKTL*
Ga0132257_10065142113300015373Arabidopsis RhizosphereAHTRDFLDKLKAKNRKTNAPMDVGYNSALPALLALEAMKGNKVLGWDPAARKSKVL*
Ga0132255_10455574513300015374Arabidopsis RhizosphereLHAHTRNFLDKLKAKDRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKTKTL*
Ga0182041_1062071313300016294SoilNRATNASLEVGYNSALPCLLALEAMKQGKVLGWDAKAAKSVVL
Ga0182034_1109506323300016371SoilFLDKLKAKNRATNAPLEIGYNSALPCLLALEAMRQNRVLGWDAKARKSVVL
Ga0184611_102745033300018067Groundwater SedimentRDFLDKLKVRNRRTNASMEIGYNSALPALLALEAMKDNKVLGWDPVARKSKVI
Ga0190271_1009278413300018481SoilPLHAHTRDFLDKLKVRNRKTNASMEIGYNSALPALLALEAMKDNKVLGWDPVARKSKAL
Ga0066669_1198799723300018482Grasslands SoilKTTAPMDVGYNSALPALPALEAMKENTVLAWDPVARKSKVV
Ga0207673_101801223300025290Corn, Switchgrass And Miscanthus RhizosphereLDCLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARTSKAL
Ga0207645_1116955623300025907Miscanthus RhizosphereLHAHTRDFLDKLKAKNRKTNASMEVGYNSALPALLALEAMKQNKVLGWDPVARKVL
Ga0207695_1034557813300025913Corn RhizosphereRATNAPLNIGYNSALPCVLALEAMRENKVLGWDAAARKSKAL
Ga0207649_1089851823300025920Corn RhizosphereCLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARTSKAL
Ga0207649_1133889823300025920Corn RhizosphereLHAHTRDFLDKMKAKNRKTNAPMEVGYNSALPALLALEAMKGNKVLGWDPVARKSKVL
Ga0207659_1079103313300025926Miscanthus RhizosphereLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARTSKAL
Ga0207686_1037200923300025934Miscanthus RhizosphereFLDKLKAKNRKTNAPMEIGYNSALPALLALEAMKDNKVLGWDATARKSKTL
Ga0207669_1130982323300025937Miscanthus RhizosphereNAPMEVGYNSALPCLLALEAMQKGRVMGWDPATKSSKVL
Ga0207651_1204841223300025960Switchgrass RhizosphereDKLKAKDRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKTKAL
Ga0207640_1198691723300025981Corn RhizosphereKTNAPMDVGYNSALPALLALEAMKENKVLGWDPVTRKSKVV
Ga0207676_1203218913300026095Switchgrass RhizosphereRDFLDKLKAKDRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKTKAL
Ga0268266_1129471213300028379Switchgrass RhizosphereRNFLDCLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARTSKAL
Ga0268265_1054154513300028380Switchgrass RhizosphereHTRNFLDCVKSRSRQTNATMEIGYNSALPCLLALEAMAQNRVLAWDPAARKSKPV
Ga0307297_1029915313300028754SoilFLDKLKAKNRKTNAPMEVGYNSALPALLALEAMKENKVLGWDAAARKSKVL
Ga0307505_1044295413300031455SoilKLKTRNRNTNASMEIGYNSALPALLALEAMKENKVLGWDPVARKPIAL
Ga0310886_1040453323300031562SoilHAHTRDFLDKLKAKNRKTNAPMEVGYNSALPALLALDAMKENKILGWDPVAKKAKVL
Ga0318561_1050850023300031679SoilKLKAKSRATNAPLEVGYNSALPCLLALEAMKQNRILGWDPKARKSVAV
Ga0310892_1104364013300031858SoilPLHAHTRDFLDKLKAKNRKTNASMDVGYNSALPALLALEAMKENKVLGWDPVARKTKVL
Ga0302322_10206273223300031902FenKNRKTNAPMEVGYNSALPALLALEAMKENKILGWDPVARKSKAL
Ga0308175_10268937523300031938SoilRNFLDKLKAKDRATNAPLNVGYNSALPCVLALEAMRENKVLGWDNVARKSKAI
Ga0310884_1102203323300031944SoilDKLKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKAL
Ga0214473_1190658323300031949SoilDFLDKLKAKDRKTNAPMDVGYNSALPALLALQAMKENKVLGWDPAAKASKVI
Ga0307416_10053319423300032002RhizosphereKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARKSKAL
Ga0310897_1019747723300032003SoilNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKAL
Ga0307411_1122046623300032005RhizosphereVHTRDFLDCLKAKNRKTAAPMEVGYNSALPCLLALEAMQQNRVLGWDAAARKSKAL
Ga0307471_10380370823300032180Hardwood Forest SoilPLHVHTRNFLDCLKAKDRKTNAPMEIGYNSALPCLLALEAMQQNRVLGWDATARKSKAQ
Ga0364929_0267560_433_5763300034149SedimentVKAKNRKTNAPMEVGYNSALPALLALEAMRENKVLGWDPVARKSKVL
Ga0370498_156577_357_5003300034155Untreated Peat SoilMKAKNRKTNAPMEVGYNSALPALLALEAMKDNKVLGWDPVARKSKVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.