| Basic Information | |
|---|---|
| Family ID | F099529 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.50 % |
| % of genes near scaffold ends (potentially truncated) | 27.18 % |
| % of genes from short scaffolds (< 2000 bps) | 83.50 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.340 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.592 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.718 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.835 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF04002 | RadC | 13.59 |
| PF01934 | HepT-like | 3.88 |
| PF13470 | PIN_3 | 2.91 |
| PF13155 | Toprim_2 | 2.91 |
| PF12323 | HTH_OrfB_IS605 | 1.94 |
| PF01541 | GIY-YIG | 0.97 |
| PF10431 | ClpB_D2-small | 0.97 |
| PF04014 | MazE_antitoxin | 0.97 |
| PF00499 | Oxidored_q3 | 0.97 |
| PF00199 | Catalase | 0.97 |
| PF02661 | Fic | 0.97 |
| PF11848 | DUF3368 | 0.97 |
| PF01850 | PIN | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 13.59 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 3.88 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 3.88 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.34 % |
| All Organisms | root | All Organisms | 44.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_103478511 | Not Available | 585 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107587979 | Not Available | 521 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109100867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2417 | Open in IMG/M |
| 3300003432|JGI20214J51088_10303141 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300003541|JGI20214J51650_10710077 | Not Available | 704 | Open in IMG/M |
| 3300003999|Ga0055469_10100976 | Not Available | 830 | Open in IMG/M |
| 3300004067|Ga0055485_10187782 | Not Available | 582 | Open in IMG/M |
| 3300005093|Ga0062594_102434032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 573 | Open in IMG/M |
| 3300005289|Ga0065704_10027976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1788 | Open in IMG/M |
| 3300005289|Ga0065704_10158462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1373 | Open in IMG/M |
| 3300005289|Ga0065704_10170911 | Not Available | 1292 | Open in IMG/M |
| 3300005289|Ga0065704_10693041 | Not Available | 564 | Open in IMG/M |
| 3300005294|Ga0065705_10156454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1860 | Open in IMG/M |
| 3300005294|Ga0065705_10719591 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005295|Ga0065707_10048071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 845 | Open in IMG/M |
| 3300005471|Ga0070698_100225564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1807 | Open in IMG/M |
| 3300005471|Ga0070698_101124557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 734 | Open in IMG/M |
| 3300005985|Ga0081539_10055824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2195 | Open in IMG/M |
| 3300006194|Ga0075427_10111171 | Not Available | 516 | Open in IMG/M |
| 3300006845|Ga0075421_100221763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2330 | Open in IMG/M |
| 3300006846|Ga0075430_100826016 | Not Available | 764 | Open in IMG/M |
| 3300006847|Ga0075431_101661945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 596 | Open in IMG/M |
| 3300006871|Ga0075434_101539366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 674 | Open in IMG/M |
| 3300006904|Ga0075424_102628372 | Not Available | 526 | Open in IMG/M |
| 3300006969|Ga0075419_10412530 | Not Available | 927 | Open in IMG/M |
| 3300007614|Ga0102946_1381027 | Not Available | 534 | Open in IMG/M |
| 3300009081|Ga0105098_10833416 | Not Available | 500 | Open in IMG/M |
| 3300009146|Ga0105091_10103544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1306 | Open in IMG/M |
| 3300009147|Ga0114129_10266158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2295 | Open in IMG/M |
| 3300009147|Ga0114129_11528033 | Not Available | 819 | Open in IMG/M |
| 3300009147|Ga0114129_11846628 | Not Available | 734 | Open in IMG/M |
| 3300009153|Ga0105094_10857614 | Not Available | 535 | Open in IMG/M |
| 3300009157|Ga0105092_10520605 | Not Available | 683 | Open in IMG/M |
| 3300009162|Ga0075423_11596154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 701 | Open in IMG/M |
| 3300009166|Ga0105100_10122030 | Not Available | 1539 | Open in IMG/M |
| 3300009166|Ga0105100_10912958 | Not Available | 548 | Open in IMG/M |
| 3300009168|Ga0105104_10506352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 680 | Open in IMG/M |
| 3300009168|Ga0105104_10744841 | Not Available | 566 | Open in IMG/M |
| 3300009168|Ga0105104_10781064 | Not Available | 554 | Open in IMG/M |
| 3300009171|Ga0105101_10029128 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 2678 | Open in IMG/M |
| 3300009179|Ga0115028_10578630 | Not Available | 834 | Open in IMG/M |
| 3300009553|Ga0105249_11915452 | Not Available | 665 | Open in IMG/M |
| 3300009804|Ga0105063_1080493 | Not Available | 519 | Open in IMG/M |
| 3300010040|Ga0126308_11202522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
| 3300010041|Ga0126312_10306752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1121 | Open in IMG/M |
| 3300010041|Ga0126312_11026572 | Not Available | 604 | Open in IMG/M |
| 3300011003|Ga0138514_100043923 | Not Available | 886 | Open in IMG/M |
| 3300011413|Ga0137333_1000311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 13214 | Open in IMG/M |
| 3300011436|Ga0137458_1086617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 885 | Open in IMG/M |
| 3300011445|Ga0137427_10467222 | Not Available | 520 | Open in IMG/M |
| 3300012161|Ga0137336_1023712 | Not Available | 1091 | Open in IMG/M |
| 3300012164|Ga0137352_1004404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2331 | Open in IMG/M |
| 3300012201|Ga0137365_10147962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1765 | Open in IMG/M |
| 3300012201|Ga0137365_10920636 | Not Available | 637 | Open in IMG/M |
| 3300012228|Ga0137459_1015911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2093 | Open in IMG/M |
| 3300012350|Ga0137372_10063351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 3212 | Open in IMG/M |
| 3300012350|Ga0137372_10617729 | Not Available | 793 | Open in IMG/M |
| 3300012353|Ga0137367_10216115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1385 | Open in IMG/M |
| 3300012353|Ga0137367_10336447 | Not Available | 1076 | Open in IMG/M |
| 3300012353|Ga0137367_10589059 | Not Available | 779 | Open in IMG/M |
| 3300012354|Ga0137366_10118151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2003 | Open in IMG/M |
| 3300012354|Ga0137366_10320689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1138 | Open in IMG/M |
| 3300012355|Ga0137369_10118542 | Not Available | 2144 | Open in IMG/M |
| 3300012356|Ga0137371_10785501 | Not Available | 726 | Open in IMG/M |
| 3300012358|Ga0137368_10224708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1316 | Open in IMG/M |
| 3300012358|Ga0137368_10796066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 585 | Open in IMG/M |
| 3300012532|Ga0137373_10582751 | Not Available | 845 | Open in IMG/M |
| 3300012676|Ga0137341_1035924 | Not Available | 821 | Open in IMG/M |
| 3300013760|Ga0120188_1048364 | Not Available | 541 | Open in IMG/M |
| 3300014255|Ga0075320_1025021 | Not Available | 988 | Open in IMG/M |
| 3300014270|Ga0075325_1201585 | Not Available | 531 | Open in IMG/M |
| 3300014304|Ga0075340_1087686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 607 | Open in IMG/M |
| 3300014317|Ga0075343_1208141 | Not Available | 514 | Open in IMG/M |
| 3300014320|Ga0075342_1183530 | Not Available | 584 | Open in IMG/M |
| 3300014320|Ga0075342_1188443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 578 | Open in IMG/M |
| 3300014322|Ga0075355_1008032 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300014867|Ga0180076_1026554 | Not Available | 972 | Open in IMG/M |
| 3300014873|Ga0180066_1047343 | Not Available | 845 | Open in IMG/M |
| 3300014875|Ga0180083_1060386 | Not Available | 792 | Open in IMG/M |
| 3300014881|Ga0180094_1100355 | Not Available | 666 | Open in IMG/M |
| 3300014884|Ga0180104_1154335 | Not Available | 678 | Open in IMG/M |
| 3300015259|Ga0180085_1036219 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua → Candidatus Scalindua rubra | 1395 | Open in IMG/M |
| 3300015374|Ga0132255_101348641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1077 | Open in IMG/M |
| 3300018075|Ga0184632_10290829 | Not Available | 708 | Open in IMG/M |
| 3300018084|Ga0184629_10268955 | Not Available | 894 | Open in IMG/M |
| 3300021090|Ga0210377_10000193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 58646 | Open in IMG/M |
| 3300021090|Ga0210377_10024947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4333 | Open in IMG/M |
| 3300021090|Ga0210377_10417920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Candidatus Denitrolinea → Candidatus Denitrolinea symbiosum | 792 | Open in IMG/M |
| 3300021090|Ga0210377_10483070 | Not Available | 719 | Open in IMG/M |
| 3300025160|Ga0209109_10296508 | Not Available | 773 | Open in IMG/M |
| 3300025313|Ga0209431_10673018 | Not Available | 768 | Open in IMG/M |
| 3300025324|Ga0209640_10444961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1064 | Open in IMG/M |
| 3300026095|Ga0207676_10603686 | Not Available | 1054 | Open in IMG/M |
| 3300026118|Ga0207675_101606561 | Not Available | 670 | Open in IMG/M |
| 3300027675|Ga0209077_1047088 | Not Available | 1178 | Open in IMG/M |
| 3300027731|Ga0209592_1018740 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
| 3300027955|Ga0209078_1092836 | Not Available | 868 | Open in IMG/M |
| 3300028380|Ga0268265_10567142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1080 | Open in IMG/M |
| 3300029304|Ga0119857_1000062 | All Organisms → cellular organisms → Bacteria | 77088 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10169236 | Not Available | 605 | Open in IMG/M |
| 3300031949|Ga0214473_10028450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6553 | Open in IMG/M |
| 3300034128|Ga0370490_0099088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 953 | Open in IMG/M |
| 3300034128|Ga0370490_0282757 | Not Available | 549 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 12.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 12.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 6.80% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.94% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.97% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Anaerobic Bioreactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029304 | Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina | Engineered | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1034785112 | 3300001213 | Wetland | MNTLEILVRILVTLIILYVLWLGYVVIVAYRWKQQDKLITRALAPRDEL* |
| JGIcombinedJ13530_1075879791 | 3300001213 | Wetland | MNAFEILVRIVAALILLYILWHGYVVVVAYRWKQEDKLISRALASRDEP* |
| JGIcombinedJ13530_1091008672 | 3300001213 | Wetland | MILETILTIVLTLFLLYILWHGYVVIVAYRWRSQDKLISRALAPRDDAL* |
| JGI20214J51088_103031412 | 3300003432 | Wetland | MNTLEILVRIGVALIILYILWHGYVVIVAYRWKQQDKLISRALAPRDEL* |
| JGI20214J51650_107100773 | 3300003541 | Wetland | MNAFAILFRIGAGLILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEL* |
| Ga0055469_101009763 | 3300003999 | Natural And Restored Wetlands | MNAFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALA |
| Ga0055485_101877822 | 3300004067 | Natural And Restored Wetlands | LVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0062594_1024340322 | 3300005093 | Soil | MNTLEILVRIVLALIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDEVL* |
| Ga0065704_100279762 | 3300005289 | Switchgrass Rhizosphere | MNAFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL* |
| Ga0065704_101584622 | 3300005289 | Switchgrass Rhizosphere | MNTFEILVRILLALILLHILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0065704_101709113 | 3300005289 | Switchgrass Rhizosphere | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0065704_106930412 | 3300005289 | Switchgrass Rhizosphere | MILETILTIVLALFLLYILWHGYVVVVAYRWKQEDKLISRALTPRDDAL* |
| Ga0065705_101564543 | 3300005294 | Switchgrass Rhizosphere | MNTFEILVRIVAGLILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEL* |
| Ga0065705_107195911 | 3300005294 | Switchgrass Rhizosphere | MNTFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEAL* |
| Ga0065707_100480712 | 3300005295 | Switchgrass Rhizosphere | MNTFEIFVRILLALIFLYILWHGYVVIVAYRWKQEDKLIS |
| Ga0070698_1002255643 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MILETILTIVLALFLLYILWHGYVVVVAYRWKQEDKLISRALAPRDDAL* |
| Ga0070698_1011245572 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTFEILVRIVLALIFLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0081539_100558242 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MNTFEILVRIALALLFLYMLWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0075427_101111712 | 3300006194 | Populus Rhizosphere | SQFHISGETMNTFEILVRILLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0075421_1002217631 | 3300006845 | Populus Rhizosphere | TMILETILTIVLALFLLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0075430_1008260163 | 3300006846 | Populus Rhizosphere | MILETILTIVLALFLLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0075431_1016619452 | 3300006847 | Populus Rhizosphere | MNTFEILVRIALALLFLHMLWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0075434_1015393662 | 3300006871 | Populus Rhizosphere | MNTFEILVRIVLALIFLYILWHGYVVIVAFRWKQEDE |
| Ga0075424_1026283721 | 3300006904 | Populus Rhizosphere | MNTFEILVRIVLALIFLYILWHGYVVIVAFRWKQEDELISRALAPRDEVL* |
| Ga0075419_104125301 | 3300006969 | Populus Rhizosphere | EILVRIALALLFLYMLWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0102946_13810271 | 3300007614 | Soil | MNAFDILINILLVLIILYILWHGYVVVVAFRWKQADKLISRALAPRDEVL* |
| Ga0105098_108334162 | 3300009081 | Freshwater Sediment | MNTFEILGRIVLALIFLYILWHGYVVIVAFRWKQEDKLISRALAPRDDVL* |
| Ga0105091_101035443 | 3300009146 | Freshwater Sediment | MNAFEILVRIVLALIILYILWHGYVVIVAYRWRQADKLISRALAPRDESF* |
| Ga0114129_102661583 | 3300009147 | Populus Rhizosphere | MNTFEILVRILLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0114129_115280331 | 3300009147 | Populus Rhizosphere | MNTIEILVRLFLALSFLYILWHGYVVIVAYRWKHEDKLISRALAPRDEVL* |
| Ga0114129_118466283 | 3300009147 | Populus Rhizosphere | RILLALIFLYILWHGYVVVVAYRWKQEDKLISRALAPRDELL* |
| Ga0105094_108576142 | 3300009153 | Freshwater Sediment | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDDAL* |
| Ga0105092_105206051 | 3300009157 | Freshwater Sediment | ILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALASRDEVL* |
| Ga0075423_115961542 | 3300009162 | Populus Rhizosphere | MNTIEILVRIILALIFLYILWHGYVVVVAFRWKQEDKLISRALAPRDEVL* |
| Ga0105100_101220305 | 3300009166 | Freshwater Sediment | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRD |
| Ga0105100_109129582 | 3300009166 | Freshwater Sediment | MILETILTIALVLFFLDILWHGYVVIVAYRWKQADKLISRALAPRDET* |
| Ga0105104_105063522 | 3300009168 | Freshwater Sediment | MNTFEILGRIVLALIFLYILWHGYVVVVAYRWKQADKLISRALAPRDDAL* |
| Ga0105104_107448411 | 3300009168 | Freshwater Sediment | MILETILTIALVLFFLYILWHGYVVIVAYRWKQEDKLISRALAPRDDVL* |
| Ga0105104_107810641 | 3300009168 | Freshwater Sediment | NPQNKSQFHNSGETMNAFEILVRIVLALSFLYILWHGYVVIVAYRWKQADKLISRALAPRDDAL* |
| Ga0105101_100291281 | 3300009171 | Freshwater Sediment | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAP |
| Ga0115028_105786301 | 3300009179 | Wetland | MNAFEILIRIVAALFLLYVLWHGYVVVIAYRWKQEDKLISRALAPRDEL* |
| Ga0105249_119154522 | 3300009553 | Switchgrass Rhizosphere | MNTFEIFVRILLALIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDEVL* |
| Ga0105063_10804932 | 3300009804 | Groundwater Sand | MNTFEILVRIVLALILLYILWHGYVVIVAYRWKQADKLISRALAPRDEVL* |
| Ga0126308_112025222 | 3300010040 | Serpentine Soil | MNAFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0126312_103067522 | 3300010041 | Serpentine Soil | MNTFEILVRFILALILRYILWHGYVVIVAYRWKQEDKLIFRALAPRDDAL* |
| Ga0126312_110265722 | 3300010041 | Serpentine Soil | FEILVRIMLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEVL* |
| Ga0138514_1000439232 | 3300011003 | Soil | MNTFEILVRIVLALILLYTLWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137333_100031116 | 3300011413 | Soil | MNTFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL* |
| Ga0137458_10866172 | 3300011436 | Soil | MNAFEILVRIVLALVFLYILWHGYVVIVAYRWKQEDKLISRALAPRDEAL* |
| Ga0137427_104672222 | 3300011445 | Soil | MNTFEILIRIVLALLILYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137336_10237121 | 3300012161 | Soil | MNTFEILVRIVLALLILYILWHGYIVLVAYRWKQEDKLISRALAPRDDVL* |
| Ga0137352_10044042 | 3300012164 | Soil | MILETILTIALVLFFVYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL* |
| Ga0137365_101479622 | 3300012201 | Vadose Zone Soil | MNTFEVLVRIVLAFIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137365_109206362 | 3300012201 | Vadose Zone Soil | MNAFEILVRIVLALILLYILWHGYIVLVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137459_10159112 | 3300012228 | Soil | MNTFEILVRIVLALLILYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137372_100633519 | 3300012350 | Vadose Zone Soil | MNAFEILVRIVLALILLYILWHGYIVLVAYRWKQEDKLISRALAPRDDVL* |
| Ga0137372_106177292 | 3300012350 | Vadose Zone Soil | MNTFEVLVRIVLAFIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDDVL* |
| Ga0137367_102161154 | 3300012353 | Vadose Zone Soil | MNTFEVLVRIVLALIFLYILWHGYVGIVAYRWKQEDKLISR |
| Ga0137367_103364474 | 3300012353 | Vadose Zone Soil | MNAFEILVRIVLALILLYILWHGYIVLVAYRWKQEDKLISR |
| Ga0137367_105890591 | 3300012353 | Vadose Zone Soil | HISGESMNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137366_101181514 | 3300012354 | Vadose Zone Soil | MNAFEILVRIVLALIILYILWHGYVVIVAYRWKQEDKLISRALAPRDDVL* |
| Ga0137366_103206891 | 3300012354 | Vadose Zone Soil | MNTFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEV |
| Ga0137369_101185424 | 3300012355 | Vadose Zone Soil | MNAFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEVP* |
| Ga0137371_107855011 | 3300012356 | Vadose Zone Soil | MNTFEILVRIVLALILLYILWHGYIVAVAYRWKQEDKLISRALAPRDDVL* |
| Ga0137368_102247085 | 3300012358 | Vadose Zone Soil | MNVFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDDV |
| Ga0137368_107960662 | 3300012358 | Vadose Zone Soil | MNAFEILVRIMLALILLYILWHGYVVVVAYRWKQEDKL |
| Ga0137373_105827512 | 3300012532 | Vadose Zone Soil | MNTFEILIRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL* |
| Ga0137341_10359241 | 3300012676 | Soil | KSQFHNSGETMNAFEILVRIVLASILLYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL |
| Ga0120188_10483642 | 3300013760 | Terrestrial | CSTCSFNPQNKSQFYICGETMNAFEIFVCIVLALNFLYILWHGYVVVVAYRWKQEDKLISRALAPRDEF* |
| Ga0075320_10250213 | 3300014255 | Natural And Restored Wetlands | MNAFEILVRIVLALILLYILWHGYVVIVAFRWRQADKLISRALAPRDEQL* |
| Ga0075325_12015852 | 3300014270 | Natural And Restored Wetlands | MNAFEILVRILLALILLYILWHGYVVIVAFRWRQADKLISRALAPRDEQL* |
| Ga0075340_10876863 | 3300014304 | Natural And Restored Wetlands | MNTFEILVRIVLALIFLYILWHGYVVIVAYRWKQADKLISRALAPRD |
| Ga0075343_12081411 | 3300014317 | Natural And Restored Wetlands | MNTFEILIRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEAL* |
| Ga0075342_11835302 | 3300014320 | Natural And Restored Wetlands | MNAFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDDVL* |
| Ga0075342_11884432 | 3300014320 | Natural And Restored Wetlands | MHTFEILVRIVLALIFLYILWHGYVVIVAYRWKQADKLISRALAPRDEAL* |
| Ga0075355_10080323 | 3300014322 | Natural And Restored Wetlands | MNTLEILVRIVVALIIFYILWHGYVVIVAYRWKQQDELISRALAPRDEL* |
| Ga0180076_10265542 | 3300014867 | Soil | MNDFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL* |
| Ga0180066_10473431 | 3300014873 | Soil | MNTFEILVRIVLALIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDEAL* |
| Ga0180083_10603861 | 3300014875 | Soil | QNKSQFHISGETMNTFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEAL* |
| Ga0180094_11003551 | 3300014881 | Soil | MNTFEILVRIVLALIFLYILWHGYVVIVAFRWKQEDKLISRALAPRDEVL* |
| Ga0180104_11543353 | 3300014884 | Soil | IVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL* |
| Ga0180085_10362194 | 3300015259 | Soil | MNTFEILVRIVLALIFLYILWHGYVVVVAYRWKQEDKLISRALAPRDEV |
| Ga0132255_1013486413 | 3300015374 | Arabidopsis Rhizosphere | LFNPKNKSQFHNFGESMNTFEILVRIVLALIFLYILWHGYVVIVAFRWKQEDKLISRALAPRDQVL* |
| Ga0184632_102908291 | 3300018075 | Groundwater Sediment | KSQFHIPGESMNTFEILVRIVLALIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDDIL |
| Ga0184629_102689553 | 3300018084 | Groundwater Sediment | MILETILTIALVLFFVYILWHGYVVIVAFRWKQEDKLISRALAPRDEVR |
| Ga0210377_1000019362 | 3300021090 | Groundwater Sediment | MILETILTIAMVLFFLYLLWHGYVVIVAYRWKQEDKLISRALAPRDDAL |
| Ga0210377_100249473 | 3300021090 | Groundwater Sediment | MNAFEILVRIVFGLIVLYLLWNGYVVIVAYRNKQIDKLISRALAPRDDVL |
| Ga0210377_104179202 | 3300021090 | Groundwater Sediment | MNTFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDDAL |
| Ga0210377_104830702 | 3300021090 | Groundwater Sediment | MNNFEILVRIVLALIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDDIL |
| Ga0209109_102965082 | 3300025160 | Soil | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDDVL |
| Ga0209431_106730181 | 3300025313 | Soil | MILETILTIALVLFFLYILWHGYVVIVAYRWKQEDKLISRALAPRDDVL |
| Ga0209640_104449613 | 3300025324 | Soil | MNTFEILVRILLALIFLYILWHGYVVLVAFRWKQEDKLISRALAPRDDVR |
| Ga0207676_106036861 | 3300026095 | Switchgrass Rhizosphere | MNTFEILVRIVAGLILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEL |
| Ga0207675_1016065611 | 3300026118 | Switchgrass Rhizosphere | EEIFEILVRIVLALIFLYILWHGYVVIVAYRWKQEDKLISRALAPRDEVL |
| Ga0209077_10470882 | 3300027675 | Freshwater Sediment | MNAFEILVRIVLALIILYILWHGYVVIVAYRWRQADKLISRALAPRDESF |
| Ga0209592_10187403 | 3300027731 | Freshwater Sediment | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL |
| Ga0209078_10928361 | 3300027955 | Freshwater Sediment | MNTFEILVRIVLALILLYILWHGYVVVVAYRWKQEDKLISRALAPRDET |
| Ga0268265_105671422 | 3300028380 | Switchgrass Rhizosphere | MNTFEILVRIVLALIFLYILWHGYVVVVAYRWKQEDKLISRALAPRDEVL |
| Ga0119857_10000627 | 3300029304 | Anaerobic Bioreactor | MNIFDILIHISLALIILYILWHGYVVVVAFRWKQADKLISRALAPRDDTL |
| (restricted) Ga0255310_101692362 | 3300031197 | Sandy Soil | MNTFEILVRIVLALLILYILWHGYIVLVAYRWKQEDKLISRALAPRDDAL |
| Ga0214473_100284508 | 3300031949 | Soil | MNTFEILVRIVLALIFLYILWHGYVVIVAFRWKQEDKLISRALAPRDEAL |
| Ga0370490_0099088_530_682 | 3300034128 | Untreated Peat Soil | MNTFEILVRIVLALILLYILWHGYVVIVAYRWKQEDKLISRALAPRDEAL |
| Ga0370490_0282757_146_298 | 3300034128 | Untreated Peat Soil | LNTFDILVRVVLALIFLYILWHGYVVIVAYRWKQADKLISRALAPRDEAL |
| ⦗Top⦘ |