| Basic Information | |
|---|---|
| Family ID | F099523 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | DLDDFPDIVGGHDIVMPAREPIVVPAAASDGDVVAGSDVEE |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.03 % |
| % of genes from short scaffolds (< 2000 bps) | 94.17 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.485 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.709 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.456 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.816 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 31.07 |
| PF14417 | MEDS | 14.56 |
| PF04679 | DNA_ligase_A_C | 9.71 |
| PF02527 | GidB | 0.97 |
| PF09414 | RNA_ligase | 0.97 |
| PF00282 | Pyridoxal_deC | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 40.78 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 31.07 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.97 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.49 % |
| All Organisms | root | All Organisms | 49.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_7231703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300000789|JGI1027J11758_12813555 | Not Available | 722 | Open in IMG/M |
| 3300000789|JGI1027J11758_12814487 | Not Available | 685 | Open in IMG/M |
| 3300003267|soilL1_10021230 | Not Available | 1210 | Open in IMG/M |
| 3300003319|soilL2_10138285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300003321|soilH1_10290704 | Not Available | 1209 | Open in IMG/M |
| 3300004114|Ga0062593_102505692 | Not Available | 584 | Open in IMG/M |
| 3300004157|Ga0062590_101636367 | Not Available | 653 | Open in IMG/M |
| 3300004643|Ga0062591_100328582 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300005093|Ga0062594_101159712 | Not Available | 761 | Open in IMG/M |
| 3300005330|Ga0070690_100427127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300005331|Ga0070670_101822383 | Not Available | 560 | Open in IMG/M |
| 3300005334|Ga0068869_101497556 | Not Available | 599 | Open in IMG/M |
| 3300005336|Ga0070680_100192583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
| 3300005343|Ga0070687_100684996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300005344|Ga0070661_101525886 | Not Available | 564 | Open in IMG/M |
| 3300005354|Ga0070675_102266554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005444|Ga0070694_100008727 | All Organisms → cellular organisms → Bacteria | 6208 | Open in IMG/M |
| 3300005444|Ga0070694_100223316 | Not Available | 1414 | Open in IMG/M |
| 3300005444|Ga0070694_100509221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300005444|Ga0070694_101335263 | Not Available | 604 | Open in IMG/M |
| 3300005539|Ga0068853_102173669 | Not Available | 538 | Open in IMG/M |
| 3300005577|Ga0068857_101182845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300005616|Ga0068852_102517847 | Not Available | 535 | Open in IMG/M |
| 3300005617|Ga0068859_102241607 | Not Available | 602 | Open in IMG/M |
| 3300005617|Ga0068859_102572308 | Not Available | 560 | Open in IMG/M |
| 3300005719|Ga0068861_100640158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300005719|Ga0068861_101520710 | Not Available | 657 | Open in IMG/M |
| 3300005840|Ga0068870_10853336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300005841|Ga0068863_100869506 | Not Available | 901 | Open in IMG/M |
| 3300005842|Ga0068858_100348852 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300005843|Ga0068860_100963081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300006358|Ga0068871_101971765 | Not Available | 555 | Open in IMG/M |
| 3300006844|Ga0075428_100852506 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006844|Ga0075428_101474416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300006852|Ga0075433_11363298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300006881|Ga0068865_102083514 | Not Available | 515 | Open in IMG/M |
| 3300006904|Ga0075424_102855084 | Not Available | 503 | Open in IMG/M |
| 3300006954|Ga0079219_10640403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300006969|Ga0075419_11216348 | Not Available | 556 | Open in IMG/M |
| 3300009011|Ga0105251_10395656 | Not Available | 635 | Open in IMG/M |
| 3300009094|Ga0111539_12159389 | Not Available | 646 | Open in IMG/M |
| 3300009098|Ga0105245_12185457 | Not Available | 607 | Open in IMG/M |
| 3300009100|Ga0075418_10594573 | Not Available | 1191 | Open in IMG/M |
| 3300009101|Ga0105247_10910285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300009148|Ga0105243_10451968 | Not Available | 1206 | Open in IMG/M |
| 3300009162|Ga0075423_12001491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300009174|Ga0105241_10540297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300009174|Ga0105241_11484114 | Not Available | 652 | Open in IMG/M |
| 3300009177|Ga0105248_10096812 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
| 3300009789|Ga0126307_10794418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300010040|Ga0126308_10590902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300010041|Ga0126312_10256424 | Not Available | 1229 | Open in IMG/M |
| 3300010159|Ga0099796_10360656 | Not Available | 629 | Open in IMG/M |
| 3300010375|Ga0105239_12370049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300010375|Ga0105239_12809646 | Not Available | 568 | Open in IMG/M |
| 3300010397|Ga0134124_10358242 | Not Available | 1376 | Open in IMG/M |
| 3300010399|Ga0134127_11116797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300010400|Ga0134122_11884838 | Not Available | 632 | Open in IMG/M |
| 3300010403|Ga0134123_13185380 | Not Available | 528 | Open in IMG/M |
| 3300012202|Ga0137363_10377253 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300012210|Ga0137378_10387763 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300012354|Ga0137366_10030004 | All Organisms → cellular organisms → Bacteria | 4221 | Open in IMG/M |
| 3300012363|Ga0137390_10163803 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300012582|Ga0137358_11078014 | Not Available | 514 | Open in IMG/M |
| 3300012930|Ga0137407_12060589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300012961|Ga0164302_10918599 | Not Available | 674 | Open in IMG/M |
| 3300012984|Ga0164309_11360728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300013297|Ga0157378_12511302 | Not Available | 567 | Open in IMG/M |
| 3300013307|Ga0157372_10782800 | Not Available | 1109 | Open in IMG/M |
| 3300013308|Ga0157375_12073584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300013760|Ga0120188_1019729 | Not Available | 695 | Open in IMG/M |
| 3300014745|Ga0157377_11515660 | Not Available | 534 | Open in IMG/M |
| 3300014968|Ga0157379_11744340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300015372|Ga0132256_101195510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300015374|Ga0132255_100850322 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300015374|Ga0132255_100861972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300021445|Ga0182009_10147310 | Not Available | 1115 | Open in IMG/M |
| 3300025900|Ga0207710_10463954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300025904|Ga0207647_10171153 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300025904|Ga0207647_10796161 | Not Available | 509 | Open in IMG/M |
| 3300025917|Ga0207660_10195564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1577 | Open in IMG/M |
| 3300025924|Ga0207694_10525437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300025926|Ga0207659_11655778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300025930|Ga0207701_11044416 | Not Available | 679 | Open in IMG/M |
| 3300025936|Ga0207670_10308872 | Not Available | 1241 | Open in IMG/M |
| 3300025938|Ga0207704_10157726 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300025941|Ga0207711_11700844 | Not Available | 574 | Open in IMG/M |
| 3300025960|Ga0207651_10315015 | Not Available | 1306 | Open in IMG/M |
| 3300025972|Ga0207668_10159887 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300026067|Ga0207678_11877380 | Not Available | 523 | Open in IMG/M |
| 3300026095|Ga0207676_10513738 | Not Available | 1139 | Open in IMG/M |
| 3300026118|Ga0207675_101333481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300027266|Ga0209215_1035677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300028381|Ga0268264_10426292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300031538|Ga0310888_10009844 | All Organisms → cellular organisms → Bacteria | 3609 | Open in IMG/M |
| 3300031548|Ga0307408_100338389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300031903|Ga0307407_10970791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031908|Ga0310900_11105767 | Not Available | 656 | Open in IMG/M |
| 3300032005|Ga0307411_10899781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300032122|Ga0310895_10323957 | Not Available | 735 | Open in IMG/M |
| 3300032211|Ga0310896_10936199 | Not Available | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.91% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0912.00005530 | 2162886012 | Miscanthus Rhizosphere | PDIVGGHDIVLPPREPVVITPASGDGDIVAAPEAEE |
| JGI1027J11758_128135552 | 3300000789 | Soil | FPDIVGGHDITLPAREPLVVAASDGDGAASSEPEE* |
| JGI1027J11758_128144872 | 3300000789 | Soil | FPDIVGGHDITLPAREPLVVAASDGDGAAPSEPEE* |
| soilL1_100212301 | 3300003267 | Sugarcane Root And Bulk Soil | EDFPDIVGGHDIVMPAREPIVVPSAGSDGDVVAGSDGEE* |
| soilL2_101382851 | 3300003319 | Sugarcane Root And Bulk Soil | ARERDLDEFPDIVGGHDIVLPSREPLVVPAGPDGDGASAPEEE* |
| soilH1_102907043 | 3300003321 | Sugarcane Root And Bulk Soil | RDLDEFPDIVGGHDIVLPPREPVVVPSAGGDGDVVAAPENEE* |
| Ga0062593_1025056922 | 3300004114 | Soil | DQARDRDLEEFPDIVGGHDIVVPPREPIIVPAAAPVDGDGVVAGPDGEE* |
| Ga0062590_1016363672 | 3300004157 | Soil | RERDLDEFPDIVGGHDIVLPTREPIVVSSGNGSGTDSDGDVVAAPESEE* |
| Ga0062591_1003285821 | 3300004643 | Soil | RDRDLEDFPDIVGGHDIVLPTREPAVVASPDGDGAAAVPEVEE* |
| Ga0062594_1011597122 | 3300005093 | Soil | DRDLEDFPDIVGGHDIVLPAREPAVVASADGDGAAAAAPEVEE* |
| Ga0070690_1004271272 | 3300005330 | Switchgrass Rhizosphere | DLDDFPDIVGGHDIVMPAREPIVVPAVASDGDGDVVAGSDGEEVS* |
| Ga0070670_1018223831 | 3300005331 | Switchgrass Rhizosphere | DQARERDLDEFPDIVGGHDIVLPTREPLVVPAGTDGDGAAAPAAPEDE* |
| Ga0068869_1014975562 | 3300005334 | Miscanthus Rhizosphere | DRDLDEFPDIVGGHDIVMPPREPIVVPSVAPADGDGAGSPEGEE* |
| Ga0070680_1001925832 | 3300005336 | Corn Rhizosphere | RDLDEFPDIVGGHDIVLPPREPVVIPTVPSDGDVVAAPEAEE* |
| Ga0070687_1006849963 | 3300005343 | Switchgrass Rhizosphere | FPDIVGGHDIVLPTREPVIVPAGNDGDGVDGDVVAAPPETEE* |
| Ga0070661_1015258862 | 3300005344 | Corn Rhizosphere | DRDLDEFPDIVGGHDIPLPVREPLVVAAASDGDGSAPSEPEE* |
| Ga0070675_1022665542 | 3300005354 | Miscanthus Rhizosphere | IDQARERDLDEFPDIVGGHDIVLPTREPLVVSATPVADGDGASAPAPEEE* |
| Ga0070694_1000087277 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EFPDIVGGHDIVMPPREPVVVPAPASNDGEIVASPDGEE* |
| Ga0070694_1002233161 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEFPDIVGGHDIVVPVREPLVVPSGSSTDGDVVAGSDVEE* |
| Ga0070694_1005092213 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EFPDIVGGHDIVVPAREPIVVPAASSNDGEVVASSDVVEE* |
| Ga0070694_1013352631 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEFPDIVGGHDIVMPSREPIVVPSAAADGDGAGSPEADE* |
| Ga0068853_1021736691 | 3300005539 | Corn Rhizosphere | DQARERELDEFPDIVGGHEIPLPTREPLVIAASDGDGASPPETEE* |
| Ga0068857_1011828453 | 3300005577 | Corn Rhizosphere | DDFPDIVGGHDIVMPAREPIVVPAASSDGDVVASPDGEE* |
| Ga0068852_1025178472 | 3300005616 | Corn Rhizosphere | DQARERDLDDFPDIVGGHDIVMPAREPIVVPSGNDGDVVAGSDGEE* |
| Ga0068859_1022416071 | 3300005617 | Switchgrass Rhizosphere | DEFPDIVGGHDIALPAREPLVVAASDGDGAAPSEPEE* |
| Ga0068859_1025723082 | 3300005617 | Switchgrass Rhizosphere | EDFPDIVGGHDIVLPAREPAVVASADGDGAAAAAPEVEE* |
| Ga0068861_1006401582 | 3300005719 | Switchgrass Rhizosphere | LDEFPDIVGGHDIVLPPREPVVITPASGDGDVVAAPEAEE* |
| Ga0068861_1015207101 | 3300005719 | Switchgrass Rhizosphere | QARDRDLEEFPDIVGGHDIVVPPREPIIVPAAAPADGDGLVAAPDGEE* |
| Ga0068870_108533361 | 3300005840 | Miscanthus Rhizosphere | IVGGHDIVMPAREPIVVPSVASDGDGDVVAAPDGEE* |
| Ga0068863_1008695061 | 3300005841 | Switchgrass Rhizosphere | IVGGHDIVLPAREPLVVPAGADGDGATPPPAEEE* |
| Ga0068858_1003488522 | 3300005842 | Switchgrass Rhizosphere | DEFPDIVGGHDIALPAREPLVVAASDGDSAAPSEPEE* |
| Ga0068860_1009630812 | 3300005843 | Switchgrass Rhizosphere | IVGGHDIVVPAREPIVVPSVASDGDVVTGSDGEE* |
| Ga0075422_100584051 | 3300006196 | Populus Rhizosphere | GRDRDLDEFPDIVGGHEIVLPPREPIVVPAAGPSDGDGVAEPDTDTDE* |
| Ga0068871_1019717651 | 3300006358 | Miscanthus Rhizosphere | RERELDEFPDIVGGHDITLPVREPLVVAASDGDGVVPSEPEE* |
| Ga0075428_1008525062 | 3300006844 | Populus Rhizosphere | FPDIVGGHDIVLPPREPAVVASAADGDGAAPPEVEE* |
| Ga0075428_1014744162 | 3300006844 | Populus Rhizosphere | DEFPDIVGGHDIVMPAREPVVVPAPASNDGEVVAGPDVEE* |
| Ga0075433_113632982 | 3300006852 | Populus Rhizosphere | IDQARERELDEFPDIVGGHDIVLPTREPLVVPAGSDGDGASAPDEE* |
| Ga0068865_1020835143 | 3300006881 | Miscanthus Rhizosphere | FPDIVGGHDIVVPVREPIVIPAGTSNDGDVVASPDVEE* |
| Ga0075424_1028550841 | 3300006904 | Populus Rhizosphere | DQARERELDEFPDIVGGHDIQLPTREPLVVAASDGDGASPPEPEE* |
| Ga0079219_106404031 | 3300006954 | Agricultural Soil | ARERELDEFPDIVGGHDIVLPTREPLVVSAAPGADGDGAAAPEEE* |
| Ga0075419_112163481 | 3300006969 | Populus Rhizosphere | VGGHDIVLPSREPVIISSGNGNATDGDVVAAPETEE* |
| Ga0105251_103956562 | 3300009011 | Switchgrass Rhizosphere | GGHDIVMPPREPIVVPSAAPADGDGAGSPPDSEE* |
| Ga0111539_121593891 | 3300009094 | Populus Rhizosphere | IVGGHDIVMPPREPVVVPAPASNDGEIVASPDGEE* |
| Ga0105245_121854571 | 3300009098 | Miscanthus Rhizosphere | DRDLEDFPDIVGGHDIVLPAREPAVVSADGDGTGTAPEVEE* |
| Ga0075418_105945731 | 3300009100 | Populus Rhizosphere | EFPDIVGGHDIVLPPREPVVVPSAAGDGDVIAAPETEE* |
| Ga0105247_109102851 | 3300009101 | Switchgrass Rhizosphere | IVGGHDIVVPVREPLVIPAADSSDGDGVVAAPDVEE* |
| Ga0105243_104519682 | 3300009148 | Miscanthus Rhizosphere | DQARERDLDDFPDIVGGHDIVMPAREPIVVPSAASDVDVVAGSDGEE* |
| Ga0075423_120014911 | 3300009162 | Populus Rhizosphere | IVGGHDIVVPAREPIVVPAASSNDGEVVASSDVVEE* |
| Ga0105241_105402972 | 3300009174 | Corn Rhizosphere | VGGHDIVIPAREPIVVPAVSSNDGDVVASPDVEE* |
| Ga0105241_114841142 | 3300009174 | Corn Rhizosphere | RDLDEFPDIVGGHDIVLPPREPVVITPASGDGDVVAAPEAEE* |
| Ga0105248_100968121 | 3300009177 | Switchgrass Rhizosphere | LDEFPDIVGGHDIVLPTREPLVVPAGTDGDGAAAPAAPEDE* |
| Ga0126307_107944182 | 3300009789 | Serpentine Soil | FPDIVGGHDIVVPAREPVVVPAAASNDGDAAPADAEE* |
| Ga0126308_105909022 | 3300010040 | Serpentine Soil | ERELDEFPDIVGGHDIVVPAREPVVVPAAASNDGDAALPDGEE* |
| Ga0126312_102564242 | 3300010041 | Serpentine Soil | EFPDIVGGHDIVVPAREPVVIPAAASNDGDAIAAPDVEE* |
| Ga0099796_103606561 | 3300010159 | Vadose Zone Soil | RELDEFPDIVGGHDIVIPTREPVVVAASDGDVPVPEVEE* |
| Ga0105239_123700492 | 3300010375 | Corn Rhizosphere | EFPDIVGGHDIVMPPREPIVVPSAAPADGDGAGSPDAEE* |
| Ga0105239_128096462 | 3300010375 | Corn Rhizosphere | ERDLEEFPDIVGGHDITLPPREPIAVAASDGDGAVLPKSEE* |
| Ga0134124_103582422 | 3300010397 | Terrestrial Soil | RDLDEFPDIVGGHDIVMPAREPIVVPSVAPVDGDGAGTPDVEE* |
| Ga0134127_111167971 | 3300010399 | Terrestrial Soil | DQARERDLDDFPDIVGGHDIVVPAREPIVVPSVASDGDGDVVTGSDGEE* |
| Ga0134122_118848381 | 3300010400 | Terrestrial Soil | IVGGHDIVMPAREPLVVPAGTPSDGEVVAGPEVEE* |
| Ga0134123_131853801 | 3300010403 | Terrestrial Soil | EFPDIVGGHDIVMPPREPIIVPAAAPADGDGLVAAPDGEE* |
| Ga0137363_103772531 | 3300012202 | Vadose Zone Soil | LDEFPDIVGGHDIVIPTREPVVVAASDGDVPVPEGEE* |
| Ga0137378_103877631 | 3300012210 | Vadose Zone Soil | EFPDIVGGHDIVIPTREPVVVATSDGDIPVPEVEE* |
| Ga0137366_100300041 | 3300012354 | Vadose Zone Soil | EFPDIVGGHDMAIPTREPVVVAGSDGEAAAPALAEPEE* |
| Ga0137390_101638031 | 3300012363 | Vadose Zone Soil | ERELDEFPDIVGGHDIVIPTREPVVVAASDGDAAVPEVEE* |
| Ga0137358_110780141 | 3300012582 | Vadose Zone Soil | QARERELDEFPDIVGGHDIVIPAREPVVVATTDGDGAAPESEE* |
| Ga0137407_120605891 | 3300012930 | Vadose Zone Soil | TIDQARERELDEFPDIVGGHEIALPPRSAVIAASGDGTSSDGHE* |
| Ga0164302_109185991 | 3300012961 | Soil | DEFPDIVGGHDITLPVREPLVVAASDGDGAVPSEPEE* |
| Ga0164309_113607282 | 3300012984 | Soil | DEFPDIVGGHDIVLPAREPLVVSAGADGDGAAPPAEEE* |
| Ga0157378_125113021 | 3300013297 | Miscanthus Rhizosphere | DLDDFPDIVGGHDIVMPAREPIVVPAAASDGDVVAGSDVEE* |
| Ga0157372_107828002 | 3300013307 | Corn Rhizosphere | DDFPDIVGGHDIVVPAREPIVVPSVASDGDGDVVTGSDGEE* |
| Ga0157375_120735842 | 3300013308 | Miscanthus Rhizosphere | RERDLDEFPDIVGGHDIVLPTREPLVVPAGTDGDGAAAPAAPEDE* |
| Ga0120188_10197291 | 3300013760 | Terrestrial | ELDEFPDIVGGHEIVIPPREPVIVPAVASTDGDVVAGSDVEE* |
| Ga0157377_115156601 | 3300014745 | Miscanthus Rhizosphere | GRERDLEEFPDIVGGHDITLPPREPIAVAATDGDGVVPVKPEE* |
| Ga0157379_117443402 | 3300014968 | Switchgrass Rhizosphere | IVGGHDIVMPAREPIVIPAVASDGDGEAAPDGEE* |
| Ga0132256_1011955101 | 3300015372 | Arabidopsis Rhizosphere | LEEFPDIVGGHDIVMPPREPIIVPSTASNDGDVLASPDVEE* |
| Ga0132255_1008503221 | 3300015374 | Arabidopsis Rhizosphere | ERELDEFPDIVGGHEIPLPTREPLVIAATDGDGASPPEPEE* |
| Ga0132255_1008619721 | 3300015374 | Arabidopsis Rhizosphere | IDQARERELDEFPDIVGGHDIVLPVREPLVVAAASDGDGAGPSEPEE* |
| Ga0182009_101473101 | 3300021445 | Soil | DIVGGHDIVLPAREPIVVASAAPVDGDGAISPETEE |
| Ga0207710_104639541 | 3300025900 | Switchgrass Rhizosphere | LEDFPDIVGGHDIVMPAREPIVVPSVASDGDAVAEPDGEE |
| Ga0207647_101711532 | 3300025904 | Corn Rhizosphere | RDRDLEDFPDIVGGHDIVLPAREPAVVASADGDGAAAAAPEVEE |
| Ga0207647_107961611 | 3300025904 | Corn Rhizosphere | ERDLDDFPDIVGGHDIVIPAREPIVVPAVASDGDGDAVAEADGEE |
| Ga0207660_101955641 | 3300025917 | Corn Rhizosphere | RDLDEFPDIVGGHDIVLPPREPVVIPTVPSDGDVVAAPEAEE |
| Ga0207694_105254371 | 3300025924 | Corn Rhizosphere | IVGGHDIVMPAREPIVVPSVASDGDGDVVAGSDGEE |
| Ga0207659_116557781 | 3300025926 | Miscanthus Rhizosphere | TIDQARERDLDEFPDIVGGHDIVLPTREPLVVSATPVADGDGASAPAPEEE |
| Ga0207701_110444161 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | IDQARERDLDEFPDIVGGHDIVLPPREPVVIPTVPSDGDVVAAPEAEE |
| Ga0207670_103088721 | 3300025936 | Switchgrass Rhizosphere | LDDFPDIVGGHDIVVPAREPIVVPSVASDGDGDVVTGSDGEE |
| Ga0207704_101577262 | 3300025938 | Miscanthus Rhizosphere | EDFPDIVGGHDIVLPAREPAVVSADGDGTGTAPEVEE |
| Ga0207711_117008441 | 3300025941 | Switchgrass Rhizosphere | DIVGGHDIVMPAREPIVVPAAASDGDVVAGSDVEE |
| Ga0207651_103150152 | 3300025960 | Switchgrass Rhizosphere | DLEDFPDIVGGHDIVMPAREPIVVPSVASDGDAVAEPDGEE |
| Ga0207668_101598872 | 3300025972 | Switchgrass Rhizosphere | RERELDEFPDIVGGHDIALPAREPLVVAASDGDGAAPSEPEE |
| Ga0207678_118773801 | 3300026067 | Corn Rhizosphere | DLDDFPDIVGGHDIVMPAREPIVIPAVASDGDGEAAADGEE |
| Ga0207676_105137382 | 3300026095 | Switchgrass Rhizosphere | ARERDLDDFPDIVGGHDIVMPAREPIVVPSAGSDGDVVAGSDGEE |
| Ga0207675_1013334812 | 3300026118 | Switchgrass Rhizosphere | QARERELDEFPDIVGGHDIVMPAREPIVVPAVSANDGDVVASPEVEE |
| Ga0209215_10356772 | 3300027266 | Forest Soil | VGGHDIVLPSREPLVVSATPVADGDGASAPTPDEE |
| Ga0268264_104262922 | 3300028381 | Switchgrass Rhizosphere | PDIVGGHDIVMPPREPIIVPAAAPADGDGLVAAPDGEE |
| Ga0310888_100098441 | 3300031538 | Soil | TIDQGRDRDLEDFPDIVGGHDIVLPAREPAVVATPDGDGAAAAVAPEVEE |
| Ga0307408_1003383891 | 3300031548 | Rhizosphere | DIVGGHDIVLPSREPLVVSAGPVADGDGASAPTTEEE |
| Ga0307407_109707912 | 3300031903 | Rhizosphere | EFPDIVGGHDIVLPSREPLVVSAGPVADGDGASAPTTEEE |
| Ga0310900_111057671 | 3300031908 | Soil | DQGRDRDLEDFPDIVGGHDIVLPAREPAVVASADGDGAAAAAPEVEE |
| Ga0307411_108997813 | 3300032005 | Rhizosphere | DLDEFPDIVGGHDIVVPAREPVVIPAAASNDGDVVAAPDVEE |
| Ga0310895_103239572 | 3300032122 | Soil | DRDLEDFPDIVGGHDIVLPAREPAVVATPDGDGAAAAVAPEVEE |
| Ga0310896_109361992 | 3300032211 | Soil | DIVGGHDIVLPAREPAVVASADGDGAAAAAPEVEE |
| ⦗Top⦘ |