NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099466

Metagenome / Metatranscriptome Family F099466

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099466
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 51 residues
Representative Sequence AYLRSLDDGTGPDPPFVDLVYRWALDYCEWGIEWCERQERRLRRAA
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.85 %
% of genes near scaffold ends (potentially truncated) 95.15 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(10.680 % of family members)
Environment Ontology (ENVO) Unclassified
(21.359 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.777 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.65%    β-sheet: 0.00%    Coil/Unstructured: 51.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF11361DUF3159 72.82
PF00881Nitroreductase 2.91
PF05147LANC_like 1.94
PF03167UDG 1.94
PF00486Trans_reg_C 0.97
PF01266DAO 0.97
PF01264Chorismate_synt 0.97
PF04191PEMT 0.97
PF13714PEP_mutase 0.97
PF04075F420H2_quin_red 0.97
PF07228SpoIIE 0.97
PF12840HTH_20 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.94
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.94
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 1.94
COG4403Lantibiotic modifying enzymeDefense mechanisms [V] 1.94
COG0082Chorismate synthaseAmino acid transport and metabolism [E] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig114457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300002568|C688J35102_120814155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1665Open in IMG/M
3300004081|Ga0063454_100449047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria885Open in IMG/M
3300004081|Ga0063454_100927567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300004479|Ga0062595_101438958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300005184|Ga0066671_10567683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300005187|Ga0066675_10842880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300005329|Ga0070683_100143503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2262Open in IMG/M
3300005332|Ga0066388_100993304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1404Open in IMG/M
3300005336|Ga0070680_101730703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300005339|Ga0070660_101551022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005344|Ga0070661_100082598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2373Open in IMG/M
3300005365|Ga0070688_101804552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300005435|Ga0070714_102387261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005447|Ga0066689_10848306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300005450|Ga0066682_10241468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300005468|Ga0070707_101441639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300005535|Ga0070684_100397384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1270Open in IMG/M
3300005544|Ga0070686_101188941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300005764|Ga0066903_101591685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1238Open in IMG/M
3300006237|Ga0097621_100608660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300006580|Ga0074049_11338766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300006804|Ga0079221_10861461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300006852|Ga0075433_11540179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300006904|Ga0075424_102328092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300009148|Ga0105243_10092901All Organisms → cellular organisms → Bacteria2489Open in IMG/M
3300009156|Ga0111538_10520520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1507Open in IMG/M
3300009156|Ga0111538_12540516All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009156|Ga0111538_12716678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300009840|Ga0126313_11671369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300010047|Ga0126382_11917137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300010323|Ga0134086_10207758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300010326|Ga0134065_10481495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300010403|Ga0134123_12615210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300012010|Ga0120118_1148940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300012019|Ga0120139_1017770All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300012357|Ga0137384_11000290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300012685|Ga0137397_10630901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300012930|Ga0137407_12005607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012961|Ga0164302_10008547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3890Open in IMG/M
3300012961|Ga0164302_10590734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300012984|Ga0164309_10184947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1420Open in IMG/M
3300012984|Ga0164309_10947861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300012989|Ga0164305_11986494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300013105|Ga0157369_10040906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5059Open in IMG/M
3300013832|Ga0120132_1007235All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300014326|Ga0157380_12732778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300015262|Ga0182007_10151590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300015371|Ga0132258_13143294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1141Open in IMG/M
3300015372|Ga0132256_100066195All Organisms → cellular organisms → Bacteria3410Open in IMG/M
3300015372|Ga0132256_100445898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300015373|Ga0132257_101854501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300015374|Ga0132255_100735588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1467Open in IMG/M
3300018032|Ga0187788_10432555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300018074|Ga0184640_10249113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300018482|Ga0066669_10538179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300018482|Ga0066669_12023207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300024279|Ga0247692_1041311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300025160|Ga0209109_10458331All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300025324|Ga0209640_10173969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1837Open in IMG/M
3300025898|Ga0207692_10601153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300025908|Ga0207643_10389460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300025915|Ga0207693_10970198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300025916|Ga0207663_10535172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300025920|Ga0207649_10170849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1514Open in IMG/M
3300025920|Ga0207649_10440971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300025924|Ga0207694_11347114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300025928|Ga0207700_11252768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300025929|Ga0207664_11915524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300025932|Ga0207690_11276648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300025932|Ga0207690_11524086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300025935|Ga0207709_11582435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales544Open in IMG/M
3300025939|Ga0207665_10806651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300026041|Ga0207639_11127094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300026318|Ga0209471_1337207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300026557|Ga0179587_11012833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300028596|Ga0247821_10880415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300028787|Ga0307323_10075638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1199Open in IMG/M
3300028828|Ga0307312_10976679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300028884|Ga0307308_10657510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300031544|Ga0318534_10335401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300031562|Ga0310886_10975731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300031770|Ga0318521_10918050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300031778|Ga0318498_10374400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300031779|Ga0318566_10226562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300031832|Ga0318499_10291744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300031939|Ga0308174_10934419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300031939|Ga0308174_11375306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300031941|Ga0310912_11443583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300031954|Ga0306926_11976152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300031996|Ga0308176_10195894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1895Open in IMG/M
3300031996|Ga0308176_11513714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300031996|Ga0308176_12527883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300031996|Ga0308176_12894092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300032001|Ga0306922_11796205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300032010|Ga0318569_10152757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1063Open in IMG/M
3300032013|Ga0310906_11172126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300032074|Ga0308173_11064881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300032180|Ga0307471_100720605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1163Open in IMG/M
3300032261|Ga0306920_102695530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300032783|Ga0335079_11466223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300033550|Ga0247829_11024561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300033814|Ga0364930_0284021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil10.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.97%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_014117602140918007SoilREGYRQMLDYLRSLDDGEGEDPAFVDLVYRWGLDYCEWGIEWCDRQERRLRLTS
C688J35102_12081415513300002568SoilLLAARREGYRGMLAYLQSLDDGTGRDPPFVDLVYRWALDYCEWGIEWCDRQERRLRRAA*
Ga0063454_10044904723300004081SoilMLAYMRTIPEGAEHPFVDLVRRWAVDYCEWGVEWCARQERRLRKQS*
Ga0063454_10092756723300004081SoilLDDGTGADPEFVDLVYRWGLDYCEWGIEWCERQERRLRRAA*
Ga0062595_10143895813300004479SoilAYLRSLDDGTGPDPPFVDLVYRWALDYCEWGIEWCERQERRLRRAA*
Ga0066671_1056768313300005184SoilYLRGLDDGEGADPPFVDLVYRWALDYCEWGIEWCDRQERRLRRAA*
Ga0066675_1084288013300005187SoilADALPTEEGLGLLLARREGYRLMHEYLRSLDDGQGPDPPFVDLVYRWALDYCEWGIEWCDRQERRLRKAA*
Ga0070683_10014350323300005329Corn RhizosphereMLEYLRGLDDGLGPDPPFVDLVYRWALDYCEWGVAWCDRELERLARAA*
Ga0066388_10099330413300005332Tropical Forest SoilGRREGYRQMLEYLRSLDDGSGQPDPPFVDLVYRWGLDYCEWGIEWCDRQERRLRQAA*
Ga0070680_10173070313300005336Corn RhizosphereGYRQMLAYLRSLDDGLGPDPPFVDLVYRWALDYCQWGVAWCDRELERLGRAA*
Ga0070660_10155102223300005339Corn RhizosphereLGLLRARREGYSRMLELLRSLDDGSGVPDTPYIDVVYRWGLDYCEWGIDWCERQERRLSWLA*
Ga0070661_10008259853300005344Corn RhizosphereMLAYLRSLDDGLGPDPPFVDLVYRWALDYCEWGVAWCDRELERLGRAA*
Ga0070688_10180455213300005365Switchgrass RhizosphereGVPDPPFVDLVYRWGLDYCEWGMEWCERQERRLKRAGQS*
Ga0070714_10238726123300005435Agricultural SoilREGYRMMLAYLRSLDDGEGADPPFVDLVYRWGLDYCEWGIEWCDRQERRLRRAP*
Ga0066689_1084830613300005447SoilSLDDGSGVPDPPFVDLVYRWALDYCEWGTEWCERQERRLRRAA*
Ga0066682_1024146833300005450SoilLDDGSGVPDPPYVDLVYRWALEYCEWGIEWCERQDRRLRRAR*
Ga0070707_10144163923300005468Corn, Switchgrass And Miscanthus RhizosphereGMLAYLRALDDGSGEPDPPFVDLVYRWALDYCEWGIEWCERQERRLQTG*
Ga0070684_10039738433300005535Corn RhizosphereMLEYLRGLDDGLGPDPPFVDLVHRWALDYCEWGVAWCERELERLARPV*
Ga0070686_10118894113300005544Switchgrass RhizosphereDTLPRDHALGLLAARREGYRGMLEYLRSLDDGTGPDPPFVDLVYRWALDYCAWGIEWCTQQEHRLRRAA*
Ga0066903_10159168533300005764Tropical Forest SoilYRQMLEYLRSLDDGSGVPDPPFVDLVYRWALDYCEWGIEWCEQQQKRLRTAAA*
Ga0097621_10060866033300006237Miscanthus RhizosphereGGEPDPPFVDLVYRWALDYCTWGIEWCEQQERRLRRAA*
Ga0074049_1133876623300006580SoilDGTGPDPTFVDLVYRWGLDYCEWGVAWCDTQESRLRRAA*
Ga0079221_1086146123300006804Agricultural SoilEGYAQMLGYLQSLDDGTGPDPPFVDLVYRWALDYCEWGIEWCERQERRLRRAA*
Ga0075433_1154017923300006852Populus RhizosphereYRAMLVYLRSLDDGTGPDPPFVDLVYRWALEYCEWGIEWCDRQERRLRRAA*
Ga0075424_10232809223300006904Populus RhizosphereRREGYRAMLAYLRSLDDGSGQPDPPFVDLVYRWALDYCAWGIEWCEQQERRLRRAA*
Ga0105243_1009290143300009148Miscanthus RhizosphereMRTYLESLDDGGGVPDTSFTDLVYRWGLDHCAWGEEWCRQQEDRLRSGG*
Ga0111538_1052052013300009156Populus RhizosphereRAMLEHLRSLDDGTGPDPTFVDLVYRWGLDYCEWGVEWCDRQQRRLRRAA*
Ga0111538_1254051623300009156Populus RhizosphereYAAMRTYLESLDDGSGVPDTPFTDLVYRWGLDHCAWGEEWCRQQEDRLRSGG*
Ga0111538_1271667823300009156Populus RhizosphereARREGYRAMLEHLRSLDDGTGPDPTFVDLVYRWGLDYCEWGITWCETQERRLRRAA*
Ga0126313_1167136913300009840Serpentine SoilGMLAYLRSLDDGTGADPDFVDLVYRWALDFCEWGIEWCERQERRLRLAA*
Ga0126382_1191713723300010047Tropical Forest SoilGLDDGSGPDPPFVDLVYRWALDSCQWGIEWCDRQERRLRQAA*
Ga0134086_1020775823300010323Grasslands SoilREGYREMLEYLRGLGGGTGHVSPPFVDLVYRWAVDYCEWGVEWCERQERRLRRAA*
Ga0134065_1048149523300010326Grasslands SoilLLRGRREGYRQLLEYVRSLERLPGPSDPPFVDLVFRWAVDYCEWGIDWCERQERRLRRAA
Ga0134123_1261521013300010403Terrestrial SoilTLPRDHALGLLAARREGYRGMLAYLRSLDDGTGPDPPFVDLVYRWALDYCAWGIEWCTQQEHRLRRAA*
Ga0120118_114894023300012010PermafrostLRALDDGTGSDPPFVDLVYRWGLDYCEWGIEWCDRQERRLRASS*
Ga0120139_101777033300012019PermafrostYGQMLDYGGTRDGGGGPAPPFVDLVYRWGLDYCRWGIEWCDHQQRRLSKAA*
Ga0137384_1100029013300012357Vadose Zone SoilEGYAGMLAYLRALDDGSGEPDPPFIDLVYRWALDYCEWGIEWCDRQERRMQTG*
Ga0137397_1063090123300012685Vadose Zone SoilGLLVARREGYRMMLAYLRSLDDGEGADPPFVDLVYRWALDYCEWGIEWCDRQERRLRRAA
Ga0137407_1200560723300012930Vadose Zone SoilMLAYLRSLDDGAGVDPPFVDLVYRWGLDYCEWGIEWCDRQERRLRQAP*
Ga0164302_1000854713300012961SoilAMLAYLRSLEDGGEPDPPFVDLVYRWSVDYCTWGIEWCEQQERRLRRAA*
Ga0164302_1059073413300012961SoilGLLRARRDGYAQMHALLRSLDDGSGEPDPRFVDLVYRWGLDYCTWGIEWCERQERRLRRRS*
Ga0164309_1018494713300012984SoilARREGYRGMLEYLRSLDDGTGADPTFVDLVYRWGLDYCEWGVAWCDTQESRLRRAA*
Ga0164309_1094786113300012984SoilGYRQMLEYLKSLDDGSGPDPDFVDLVYRWGLDYCEWGIEWCDRQERRLQQAEAA*
Ga0164305_1198649413300012989SoilQMLEYLKSLDDGTGPDPPFVDLVYRWGLDYCEWGIQWCDQQERRLRQAA*
Ga0157369_1004090673300013105Corn RhizosphereMLEYLRGLDDGLGPDPPFVDLVYRWALDYCEWGVAWCDRELERLARAV*
Ga0120132_100723513300013832PermafrostLEYRQTLDQARGPDPPFVDLVYRWGLDYCRWGIEWCDHQQRRLSKAA*
Ga0157380_1273277813300014326Switchgrass RhizosphereEHGLGLLAARREGYRAMLAYLRSLDDGGEPDPPFVDLVYRWALDYCAWGIEWCEQQERRLRRAA*
Ga0182007_1015159023300015262RhizosphereLDDGSGVPDPPYIDLVYRWALDYCEWGIDWCNRQERRLRRG*
Ga0132258_1314329443300015371Arabidopsis RhizospherePDPPFVDLVYRWGLDYCEWGIEWCEQQTRRLTRAA*
Ga0132256_10006619573300015372Arabidopsis RhizosphereYLRGLDDGLGPDPPFVDLVYRWALDYCEWGVAWCDRELKRLARAA*
Ga0132256_10044589843300015372Arabidopsis RhizosphereARREGYRAMLDYLRSLDDGTGPDPPFVDLVYRWALDYCEWGIGWCEQQERRLRPAA*
Ga0132257_10185450113300015373Arabidopsis RhizosphereHALGLLSARREGYRGVLAYLRSLDDGTGPDPDFVDLVYRWGLDYCEWGIEWCERQERRLRRAA*
Ga0132255_10073558833300015374Arabidopsis RhizosphereLDDGTGPDPTFVDLVYRWGLDYCEWGVEWCDRQQRRLRRAA*
Ga0187788_1043255513300018032Tropical PeatlandMLEYLKSLDDGSGQPDPPFVDLVYRWGLDYCRWGIDWCDEQERRLRQEAAA
Ga0184640_1024911323300018074Groundwater SedimentGLLTARREGYRQMLEYLQGLDDGSGPDPPFVDLVYRWALDYCQWGIEWCSRQERRMRRAA
Ga0066669_1053817913300018482Grasslands SoilGPDPPFVDLVYRWGLDYCQWGIEWCDRQERRLRRAA
Ga0066669_1202320713300018482Grasslands SoilGYRQMLGYLRSLDDGTGPDPPFVDLVYRWGLDYCEWGIEWCDRQERRLRRAA
Ga0247692_104131123300024279SoilLQSLDDGQGADPPFVDLVYRWALDYCEWGIEWCDRQQRRLRPAA
Ga0209109_1045833123300025160SoilREGYRRLHAYLRGLDDGQSKDPPFVDLVYQWGLDYCEWGIEWCDRQESRLRRAA
Ga0209640_1017396913300025324SoilRSLDDGQSTDPPFVDLVYQWGLDYCEWGIEWCDRQESRLRRAA
Ga0207692_1060115323300025898Corn, Switchgrass And Miscanthus RhizosphereDDGSGVADPPFIDLVYRWGLDYCEWGMEWCNRQELRLRQAS
Ga0207643_1038946013300025908Miscanthus RhizosphereLDDGTGPDPTFVDLVYRWGLDYCEWGVEWCDRQQRRLRRAA
Ga0207693_1097019833300025915Corn, Switchgrass And Miscanthus RhizosphereRAMLAYLRSLDDGGEPDPPFVDLVYRWALDYCTWGIEWCEQQERRLRRAA
Ga0207663_1053517223300025916Corn, Switchgrass And Miscanthus RhizosphereRREGYRAMFEYLRSLDDGSGVADPPFIDLVYRWGLDYCEWGIEWCNRQELRLRQAS
Ga0207649_1017084933300025920Corn RhizosphereLDDGGEPDPPFIDLVYRWGMDYCAWGIEWCDRQERRLRSSS
Ga0207649_1044097133300025920Corn RhizosphereSLDDGTGPDPTFVDLVYRWGLDYCEWGVEWCDRQQRRLRRAA
Ga0207694_1134711423300025924Corn RhizosphereDYLRSLDDGGEPDPPFIDLVYRWGMDYCAWGIEWCDRQERRLRSSS
Ga0207700_1125276823300025928Corn, Switchgrass And Miscanthus RhizosphereDDGSGQPDPPFVDLVYRWGLDYCEWGIEWCDRQERRLRQAA
Ga0207664_1191552423300025929Agricultural SoilREGYRMMLAYLRSLDDGEGADPPFVDLVYRWGLDYCEWGIEWCDRQERRLRRAP
Ga0207690_1127664813300025932Corn RhizosphereVPDPPYIDVVYRWGLDYCEWGIDWCERQERRLSRLA
Ga0207690_1152408613300025932Corn RhizosphereGLGPDPPFVDLVYRWALDYCEWGVAWCDRELERLGRAA
Ga0207709_1158243513300025935Miscanthus RhizosphereGSGQPDPPFVDLVYRWGLDYCQWGIEWCEQQERRLTRAA
Ga0207665_1080665123300025939Corn, Switchgrass And Miscanthus RhizosphereEGLGLLRARREGYRAMFEYLRSLDDGSGVADPPFIDLVYRWGLDYCEWGMEWCNRQELRLRQAS
Ga0207639_1112709413300026041Corn RhizosphereRSLDDGEGADPPFVDLVYRWGLDYCEWGIEWCDRQERRLRRAP
Ga0209471_133720713300026318SoilDDGEGADPPFVDLVYRWALDYCEWGIEWCDRQERRLRRAA
Ga0179587_1101283313300026557Vadose Zone SoilRDGYAGMLAYLRALDDGSGEPDPPFIDLVYRWALDYCEWGIEWCERQERRLQTG
Ga0247821_1088041523300028596SoilSDGTGPDPTFVDLVYRWGLDYCEWGVEWCDRQQRRLRRAA
Ga0307323_1007563833300028787SoilMLAHLRALDDGTGPDPPFVDLVYRWGLDYCQWGIEWCSRQERRLRRAA
Ga0307312_1097667923300028828SoilAQLRALDDGTGPDPPFVDLVYRWGIDYCEWGVEWCARQERRLRRAA
Ga0307308_1065751023300028884SoilEQMLAHLRALDDGTGPDPPFVDLVYRWGLDYCQWGIEWCSRQERRMRRAA
Ga0318534_1033540123300031544SoilSDAIPFEHGLGLLAGRREGYTRMYEYLRSLDDGSGVPDPPFVDLAYRWGLDYCKWGMDWCDQQAQRMREENERAA
Ga0310886_1097573123300031562SoilAYLRSLDDGTGPDPDFVDLVYRWGLDYCEWGIEWCERHERRLGRAA
Ga0318521_1091805023300031770SoilGPDPPFVDVVYRWGLDHCRWGIDWCDSQARRLREAA
Ga0318498_1037440013300031778SoilEHLVSLDDGTGPDPPFVDVVYRWGLDHCRWGIDWCDSQARRLREAA
Ga0318566_1022656223300031779SoilDHALGLLAARREGYRQMLEHLVSLDDGTGPDPPFVDVVYRWGLDHCRWGIDWCDSQARRLREAA
Ga0318499_1029174423300031832SoilDAIPFEHGLGLLAGRREGYTRMYEYLRSLDDGSGVPDPPFVDLAYRWGLDYCKWGMDWCDQQAQRMREENERAA
Ga0308174_1093441923300031939SoilDDGTGPDPPFVDVVYRWGLDHCEWGIEWCDRQERRLRQSS
Ga0308174_1137530613300031939SoilPHDRGLGLLAARREGYWQMLDYLRSLDDGLGPDPPFVDLVYRWALDYCEWGVAWCDRELERLARAA
Ga0310912_1144358323300031941SoilLSTRREGYRAMLEYLRSLDDGTGPDPPFIDLVYRWALDYCEWGIEWCERQERRLRRAA
Ga0306926_1197615213300031954SoilVSLDDGTGPDPPFVDVVYRWGLDHCRWGIDWCDSQARRLREAA
Ga0308176_1019589413300031996SoilEEALGLLAARREGYRMMLAYLRGLDDGTGPDPPFVDVVYRWGLDHCEWGIEWCDRQERRLRQSS
Ga0308176_1151371423300031996SoilSLDDGSGVPDPPFIDLVYRWGLDYCEWGIEWCERQERRLRRQR
Ga0308176_1252788323300031996SoilALGLLRARRDGYAGMLAYLRSLDDGSGVPDPPYIDLVYRWALDYCEWGIDWCNRQERRLRRG
Ga0308176_1289409223300031996SoilPADEAVGLLRARRAGYEAMLGYLRSLDDGSGVPDPPFVDVVYRWALDYCEWGAEWCRKQEQRLRRAV
Ga0306922_1179620513300032001SoilYEYLRSLDDGSGVPDPPFVDLAYRWGLDYCKWGMDWCDQQAQRMREENERAA
Ga0318569_1015275733300032010SoilPYDHALGLLAARREGYRQMLEHLVSLDDGTGPDPPFVDVVYRWGLDHCRWGIDWCDSQARRLREAA
Ga0310906_1117212623300032013SoilEGYRQMLRYLQSLDDGSGEPDPPFVDLVYRWGLDYCEWGMEWCERQERRLKRAAQS
Ga0308173_1106488113300032074SoilYEQMLAHLRSLDDGSGSDPPFVDLVYQWGLDYCEWGIEWCNRQERRLRRAA
Ga0307471_10072060533300032180Hardwood Forest SoilGYRAMLEYLRGLDDGQGADPTFVDLVYRWGLDYCEWGIEWCDRQERRLRRAA
Ga0306920_10269553013300032261SoilGYRAMLEYLRSLDDGTGPDPPFIDLVYRWALDYCEWGIEWCDRQERRLRLAA
Ga0335079_1146622313300032783SoilHARREGYRQMLAYLEGLDDGQGEDPPFVDLVYRWGLDYCRWGIEWCERQERRLRPAV
Ga0247829_1102456123300033550SoilGTGPDPDFVDLVYRWGLDYCEWGIEWCERHERRLGRAA
Ga0364930_0284021_391_5583300033814SedimentRREGYRRLHAYLRSLDDGQSKDPPFVDLVYQWGLDYCEWGIEWCDRQERRLRRAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.