Metagenome Family F099461

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F099461
Family Type	Metagenome
Number of Sequences	103
Average Sequence Length	41 residues
Representative Sequence	MTLLSVVKDVCAAVGVTLPQSVFSNITGNRTMQEMVSLANE
Number of Associated Samples	80
Number of Associated Scaffolds	103

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	97.09 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	92.23 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (79.612 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.447 % of family members)
Environment Ontology (ENVO)	Unclassified (45.631 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (46.602 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 103 Family Scaffolds
PF01833	TIG	1.94
PF07460	NUMOD3	0.97

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.52 %
Unclassified	root	N/A	17.48 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	79.61 %
Unclassified	root	N/A	17.48 %
Viruses	superkingdom	All Organisms → Viruses	2.91 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	79.61 %
Unclassified	root	N/A	17.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %

Name	Rank	Taxonomy	Distribution
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	57.28 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	21.36 %
Unclassified	root	N/A	17.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %

Name	Rank	Taxonomy	Distribution
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	57.28 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	19.42 %
Unclassified	root	N/A	17.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.97 %

Name	Rank	Taxonomy	Distribution
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	57.28 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18.45 %
Unclassified	root	N/A	17.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.97 %

Name	Rank	Taxonomy	Distribution
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	57.28 %
Unclassified	root	N/A	17.48 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	2.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.97 %

Name	Rank	Taxonomy	Distribution
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	57.28 %
Unclassified	root	N/A	17.48 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	2.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.97 %

Name	Rank	Taxonomy	Distribution
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	57.28 %
Unclassified	root	N/A	17.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.91 %
Mesorhizobium ciceri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium ciceri	0.97 %
Paraburkholderia xenovorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia xenovorans	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001430\|JGI24032J14994_103443	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	534	Open in IMG/M
3300002073\|JGI24745J21846_1041216	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	573	Open in IMG/M
3300004157\|Ga0062590_102999497	Not Available	506	Open in IMG/M
3300004643\|Ga0062591_102767066	Not Available	519	Open in IMG/M
3300005295\|Ga0065707_10915664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	561	Open in IMG/M
3300005355\|Ga0070671_100780903	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	831	Open in IMG/M
3300005356\|Ga0070674_100314440	All Organisms → Viruses → Predicted Viral	1253	Open in IMG/M
3300005367\|Ga0070667_100254626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1570	Open in IMG/M
3300005466\|Ga0070685_10771252	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	707	Open in IMG/M
3300005543\|Ga0070672_100996301	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	742	Open in IMG/M
3300005544\|Ga0070686_100412434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1030	Open in IMG/M
3300005618\|Ga0068864_100374180	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1349	Open in IMG/M
3300005718\|Ga0068866_10037377	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2384	Open in IMG/M
3300005718\|Ga0068866_10430508	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	858	Open in IMG/M
3300005718\|Ga0068866_10539630	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	778	Open in IMG/M
3300006237\|Ga0097621_101096900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	747	Open in IMG/M
3300006237\|Ga0097621_101606908	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	618	Open in IMG/M
3300006237\|Ga0097621_101639319	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	612	Open in IMG/M
3300006358\|Ga0068871_100597087	All Organisms → Viruses → Predicted Viral	1004	Open in IMG/M
3300006358\|Ga0068871_102207124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium ciceri	525	Open in IMG/M
3300006852\|Ga0075433_10667247	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	911	Open in IMG/M
3300009081\|Ga0105098_10819299	Not Available	504	Open in IMG/M
3300009146\|Ga0105091_10080133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1479	Open in IMG/M
3300009146\|Ga0105091_10135634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1147	Open in IMG/M
3300009148\|Ga0105243_10049002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3332	Open in IMG/M
3300009168\|Ga0105104_10161445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1214	Open in IMG/M
3300009176\|Ga0105242_10084328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2662	Open in IMG/M
3300009176\|Ga0105242_10830806	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	917	Open in IMG/M
3300009176\|Ga0105242_11045755	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	827	Open in IMG/M
3300009176\|Ga0105242_11471366	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	711	Open in IMG/M
3300009177\|Ga0105248_10623626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1217	Open in IMG/M
3300009177\|Ga0105248_12196586	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	628	Open in IMG/M
3300009553\|Ga0105249_12733755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia xenovorans	565	Open in IMG/M
3300009553\|Ga0105249_13155006	Not Available	530	Open in IMG/M
3300009610\|Ga0105340_1005204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5348	Open in IMG/M
3300010398\|Ga0126383_13224304	Not Available	533	Open in IMG/M
3300011400\|Ga0137312_1028886	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	835	Open in IMG/M
3300011403\|Ga0137313_1098204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	530	Open in IMG/M
3300011412\|Ga0137424_1119137	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	551	Open in IMG/M
3300011430\|Ga0137423_1027114	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1757	Open in IMG/M
3300011432\|Ga0137428_1002406	All Organisms → cellular organisms → Bacteria	6641	Open in IMG/M
3300011438\|Ga0137451_1018048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2035	Open in IMG/M
3300012122\|Ga0137332_1034693	Not Available	588	Open in IMG/M
3300012882\|Ga0157304_1037716	Not Available	696	Open in IMG/M
3300012885\|Ga0157287_1007847	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1158	Open in IMG/M
3300012893\|Ga0157284_10051670	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	940	Open in IMG/M
3300012895\|Ga0157309_10131737	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	725	Open in IMG/M
3300012895\|Ga0157309_10151398	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	690	Open in IMG/M
3300012895\|Ga0157309_10188532	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	638	Open in IMG/M
3300012903\|Ga0157289_10411472	All Organisms → cellular organisms → Bacteria → Proteobacteria	511	Open in IMG/M
3300012905\|Ga0157296_10004043	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2115	Open in IMG/M
3300012915\|Ga0157302_10334065	Not Available	601	Open in IMG/M
3300012916\|Ga0157310_10145184	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	814	Open in IMG/M
3300012916\|Ga0157310_10430859	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	556	Open in IMG/M
3300012925\|Ga0137419_10890950	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	732	Open in IMG/M
3300012985\|Ga0164308_10815757	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	815	Open in IMG/M
3300013306\|Ga0163162_11764226	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	707	Open in IMG/M
3300013308\|Ga0157375_12056032	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	679	Open in IMG/M
3300014969\|Ga0157376_10288337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1549	Open in IMG/M
3300014969\|Ga0157376_10606516	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1090	Open in IMG/M
3300015077\|Ga0173483_10812464	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	541	Open in IMG/M
3300015374\|Ga0132255_104403396	Not Available	597	Open in IMG/M
3300015374\|Ga0132255_104738821	Not Available	576	Open in IMG/M
3300017965\|Ga0190266_10293961	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	843	Open in IMG/M
3300017965\|Ga0190266_10914775	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	577	Open in IMG/M
3300018031\|Ga0184634_10253158	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	807	Open in IMG/M
3300018031\|Ga0184634_10445003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	585	Open in IMG/M
3300018072\|Ga0184635_10395478	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	524	Open in IMG/M
3300018073\|Ga0184624_10147232	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1034	Open in IMG/M
3300018073\|Ga0184624_10307811	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	710	Open in IMG/M
3300018077\|Ga0184633_10611268	Not Available	513	Open in IMG/M
3300018082\|Ga0184639_10252486	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	932	Open in IMG/M
3300018083\|Ga0184628_10019962	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3292	Open in IMG/M
3300018481\|Ga0190271_11942603	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	698	Open in IMG/M
3300019362\|Ga0173479_10467854	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	627	Open in IMG/M
3300019884\|Ga0193741_1103355	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	728	Open in IMG/M
3300021082\|Ga0210380_10116532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1187	Open in IMG/M
3300021082\|Ga0210380_10291727	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	742	Open in IMG/M
3300022901\|Ga0247788_1101831	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	568	Open in IMG/M
3300022906\|Ga0247766_1035617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1238	Open in IMG/M
3300022906\|Ga0247766_1178268	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	555	Open in IMG/M
3300022911\|Ga0247783_1243285	Not Available	521	Open in IMG/M
3300023069\|Ga0247751_1020489	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1032	Open in IMG/M
3300023169\|Ga0247762_1019717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1893	Open in IMG/M
3300023270\|Ga0247784_1083977	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	802	Open in IMG/M
3300024055\|Ga0247794_10350157	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	505	Open in IMG/M
3300024187\|Ga0247672_1031727	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	858	Open in IMG/M
3300024284\|Ga0247671_1083250	Not Available	533	Open in IMG/M
3300025899\|Ga0207642_10555792	Not Available	709	Open in IMG/M
3300025920\|Ga0207649_11514680	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	531	Open in IMG/M
3300025923\|Ga0207681_11371189	Not Available	594	Open in IMG/M
3300025934\|Ga0207686_10425215	All Organisms → Viruses → Predicted Viral	1017	Open in IMG/M
3300025934\|Ga0207686_10579215	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	881	Open in IMG/M
3300025935\|Ga0207709_10234129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1332	Open in IMG/M
3300025937\|Ga0207669_10968933	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	713	Open in IMG/M
3300025937\|Ga0207669_11663296	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	545	Open in IMG/M
3300025938\|Ga0207704_10669282	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	857	Open in IMG/M
3300025941\|Ga0207711_11760536	Not Available	563	Open in IMG/M
3300027743\|Ga0209593_10237428	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	635	Open in IMG/M
3300028014\|Ga0265345_101275	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	890	Open in IMG/M
3300028819\|Ga0307296_10813379	Not Available	509	Open in IMG/M
3300031562\|Ga0310886_10771634	Not Available	603	Open in IMG/M
3300031719\|Ga0306917_10882560	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	700	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.17%
Host-Associated	Host-Associated	38.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	38.83%
Plants	Host-Associated → Plants	38.83%
Aquatic	Environmental → Aquatic	22.33%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	33.01%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.27%
Sediment	Environmental → Aquatic → Sediment	15.53%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.71%
Freshwater	Environmental → Aquatic → Freshwater	6.80%
Plant Litter	Environmental → Terrestrial → Plant Litter	5.83%
Roots	Host-Associated → Plants → Roots	4.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	15.53%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.77%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.77%
Sediment	Environmental → Aquatic → Freshwater → Sediment	6.80%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	5.83%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	4.85%
Loam	Environmental → Terrestrial → Soil → Loam	1.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	15.53%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.77%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	6.80%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	5.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.85%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	4.85%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.97%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	18.45%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	7.77%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	7.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	7.77%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	5.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	4.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	4.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	4.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.91%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.94%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.94%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.97%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.97%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.97%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.97%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Environmental	Open in IMG/M
3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Host-Associated	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011400	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2	Environmental	Open in IMG/M
3300011403	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2	Environmental	Open in IMG/M
3300011412	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300012122	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2	Environmental	Open in IMG/M
3300012882	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2	Environmental	Open in IMG/M
3300012885	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4	Environmental	Open in IMG/M
3300022906	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6	Environmental	Open in IMG/M
3300022911	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5	Environmental	Open in IMG/M
3300023069	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5	Environmental	Open in IMG/M
3300023169	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4	Environmental	Open in IMG/M
3300023270	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5	Environmental	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300024187	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13	Environmental	Open in IMG/M
3300024284	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028014	Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE2	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24032J14994_1034431	3300001430	Corn, Switchgrass And Miscanthus Rhizosphere	MTLLSVTKDVCAAVGVLIPPTSVFISITGNRTMQEMLSLAN
JGI24745J21846_10412162	3300002073	Corn, Switchgrass And Miscanthus Rhizosphere	MTLLSVTKDVCAAVGVLIPPTSVFTSITGNRTMQEMLSLANEMAQRI
Ga0062590_1029994971	3300004157	Soil	MSLLTVVKDVCAAVGVMVPQTVFGGINSNRTMQEMVSLANEMAQRIA
Ga0062591_1027670661	3300004643	Soil	MTVLTVVKDVCAAVGVMVPSTVFGGINSNRTMQEMVSLAN
Ga0065707_109156641	3300005295	Switchgrass Rhizosphere	MTILSVVQDVCATVGVAVPSTVFGGITNNRTMQEMLALANEMAQ
Ga0070671_1007809031	3300005355	Switchgrass Rhizosphere	MSLLTVVKDVCATVGVQVPTSVFGGIANNRTMQEMLALANEM
Ga0070674_1003144401	3300005356	Miscanthus Rhizosphere	MTILTVVQDVCAVVGVVVPNTLFGSIGANRTMQEMTRLANEMAQ
Ga0070667_1002546261	3300005367	Switchgrass Rhizosphere	MTILSIIRDVCATVGVVQPTSVFAGIAGNRTMTEMLSLANEVAQRI
Ga0070685_107712521	3300005466	Switchgrass Rhizosphere	MSLLTVVKDVCATVGVQVPQTVFGGIANNRTMQEMLALANEM
Ga0070672_1009963011	3300005543	Miscanthus Rhizosphere	MTILSVTRDVCAAVGVLLPSSVFSNLAGNRTMQEMLA
Ga0070686_1004124342	3300005544	Switchgrass Rhizosphere	MTILAVVKDVCATVGVMVPTSVFSGLGSNRTMQEMVSLAN
Ga0068864_1003741803	3300005618	Switchgrass Rhizosphere	MTILSVVKDVCAAVGVLIPQSLFSNLTGNRTAQEMLSLA
Ga0068866_100373774	3300005718	Miscanthus Rhizosphere	MTLLSVTKDVCAAVGVLIPPTSVFTSITGNRTMQEMLSLANEMAQ
Ga0068866_104305081	3300005718	Miscanthus Rhizosphere	MTLLSVVQDVCATVGVVMPTAIFSNITGNRTMQEMVS
Ga0068866_105396302	3300005718	Miscanthus Rhizosphere	MTILSVVRSVCATVGVLTPTSVFTNIAGNRTMQEMLDL
Ga0097621_1010969001	3300006237	Miscanthus Rhizosphere	MTILSVVKDVCLAVGVAVPQSIFTNLTGNRTMQEMLSLANEMAQR
Ga0097621_1016069081	3300006237	Miscanthus Rhizosphere	MTILSVVKDVCATVGVLMPQSMFSNITGNRTMQEMLALA
Ga0097621_1016393192	3300006237	Miscanthus Rhizosphere	MTLLSVIKDVCATVGVLIPSSVFSNLTGNRTMQEMVS
Ga0068871_1005970872	3300006358	Miscanthus Rhizosphere	MTLLSVIRDVCATVGVLIPSSVFSNLTGNRTMQEMVSGANEMAQRIAYDK
Ga0068871_1022071242	3300006358	Miscanthus Rhizosphere	MALLSVIKDVCATVGVTIPSSVFSNITGNRTMQEMLSLANEMAQ
Ga0075433_106672472	3300006852	Populus Rhizosphere	MTILSVVREVCGVVGVVKPSSLFASINSNRTMQEMLDLANE
Ga0105098_108192991	3300009081	Freshwater Sediment	MSLLTVVRDVCAVVGVAAPSSVFAALGSNRTMFEMLACANEMAQR
Ga0105091_100801331	3300009146	Freshwater Sediment	MTILSVVRDVCTTVGVVQPTSVFAGITGNRTMQEMVT
Ga0105091_101356343	3300009146	Freshwater Sediment	MSLLTVVQDVCAVVGVQRPTTVFASITTNRTMFEMATLATEMAQRIAY
Ga0105243_100490024	3300009148	Miscanthus Rhizosphere	MTLLSVVQDVCAVVGVLRPQSVFSNITGNRTMQEMLVLA
Ga0105104_101614451	3300009168	Freshwater Sediment	MTLLTVVRDVCAVVGVAAPASVFAAISSNRTMFEMV
Ga0105242_100843284	3300009176	Miscanthus Rhizosphere	MTLLSVVKDVCSVVGVIQPSSVFTNITGTRTMQEMLSLANEMAQR
Ga0105242_108308062	3300009176	Miscanthus Rhizosphere	MSLLTVVQDVCAHVGVTYPNSVFSNIASNRSMQEML
Ga0105242_110457552	3300009176	Miscanthus Rhizosphere	MTMTLLSVVKDVCAVVGVTIPQSVFSNITGNRTMQEMLSLANEM
Ga0105242_114713661	3300009176	Miscanthus Rhizosphere	MSLLSVAKDVCAAVGVAYPTSVFSGISDSRTMQEMLAVANE
Ga0105248_106236261	3300009177	Switchgrass Rhizosphere	MTLLTVVKDVCAVVGVTVPTSVTLNIAANRTMQEMLAL
Ga0105248_121965862	3300009177	Switchgrass Rhizosphere	MTLLSVVKDVCAAVGVLVPTSVMTNIAANRTMQEMLALA
Ga0105249_127337551	3300009553	Switchgrass Rhizosphere	MEGIVTLLSVVKDVCATVGVTIPSSVFSNITGNRTMQEM
Ga0105249_131550061	3300009553	Switchgrass Rhizosphere	MSLLTVVQDVCAVVGVIVPTSVFTNINANRTMQEMVAWANEMAQRIGGEER
Ga0105340_10052047	3300009610	Soil	MTILTVVRDVCAVVGVVTPTSVFAALAANRTMQEMVNLANEMAQRI
Ga0126383_132243042	3300010398	Tropical Forest Soil	MSLISVVKDVCVAVGVLVPTSVFTNITGNRTMQEMLSLANEMA
Ga0137312_10288862	3300011400	Soil	MSLVTTVRDVCAVVGVAAPTSVFANISTNRTMFEML
Ga0137313_10982042	3300011403	Soil	MTLLTVVRDVCAVVGVELPNSVFTNIAANRTMQEMLALANETAQRIAYDTREWTRLRKVHTC
Ga0137424_11191371	3300011412	Soil	MTLLSVVKDVCAAVGVLAPQSVFSSITGNRTMQEMLS
Ga0137423_10271144	3300011430	Soil	MTLLSVVKDVCQVVGVQQPTSVYANIIGNRTMQEMAALAT
Ga0137428_100240610	3300011432	Soil	MTIYTVVRDVCAAVGVTVPNSVFASVNTNRTMTEMVALANEMA
Ga0137451_10180483	3300011438	Soil	MTILSVIKDVCATVGVLVPQSVFSNITGNRTMQEMVSLA
Ga0137332_10346932	3300012122	Soil	MTLLSVVKDVCAAVGVTLPQSVFSNITGNRTMQEMVSLANE
Ga0157304_10377161	3300012882	Soil	MTLLTVVRDVCAAVGVALPGSVFGGLNTNRTMQEMVSLANEM
Ga0157287_10078473	3300012885	Soil	MTLLTVTRDVCAAVGVMVPTTVFGGINSNRTMQEMVALANEMAQRISY
Ga0157284_100516703	3300012893	Soil	MTILQVVKDVCAVVGVVVPNTVFGNITANRTMQEMVTLANEM
Ga0157309_101317371	3300012895	Soil	MTLLSVVRDVCAVVGVNIPTAVTTNLAANRTMQEM
Ga0157309_101513981	3300012895	Soil	MTLLAVVRDVCATVGVMMPQTVFGSINTNRTMQEMV
Ga0157309_101885321	3300012895	Soil	MALLQVVKDVCAAVGVAVPQSVFSNITGNRTMQEM
Ga0157289_104114722	3300012903	Soil	MSLLSVVKDVCATVGVQVPQTVFGGIANNRTMQEML
Ga0157296_100040431	3300012905	Soil	VTILSTVKDVCAVVGVLLPTSVFNNTIDKRTMSEMVTLANEM
Ga0157302_103340652	3300012915	Soil	MTLLTVTRDVCAAVGVMVPTTVFGGINSNRTMQEMVALANEMAQRISYDLR
Ga0157310_101451842	3300012916	Soil	MSLLTVVKDVCATVGVQVPTSVFGGIANNRTMQEM
Ga0157310_104308592	3300012916	Soil	MTLLSVVRDVCAVVGVLQPQSVFSNITGNRTLQEMLALANEM
Ga0137419_108909501	3300012925	Vadose Zone Soil	MTILTVVKDVCAAVGVAVPTSVFASLIANRTMQEMVALANEM
Ga0164308_108157571	3300012985	Soil	MSLLSVVKDVCAVVGVQQPTSVTTNLVANRTMQEML
Ga0163162_117642262	3300013306	Switchgrass Rhizosphere	MTMTLLSVVKDVCAAVGVTIPVSVFSNITGNRTMQEMLSL
Ga0157375_120560322	3300013308	Miscanthus Rhizosphere	MTMTLLSVVKDVCATVGVTIPTSVFSNITGNRTMQEMLSLAN
Ga0157376_102883373	3300014969	Miscanthus Rhizosphere	MSLLTVVRDVCAVVGVTQPISVVAAIGSNRTMAEMLALANEMGQRIAYDTRDWQ
Ga0157376_106065161	3300014969	Miscanthus Rhizosphere	MTILSVVKDVCLAVGVAVPQSIFTNLTGNRTMQEML
Ga0173483_108124642	3300015077	Soil	MTLLAVVRDVCATVGVQVPTSVFGGIANNRTMQEML
Ga0132255_1044033961	3300015374	Arabidopsis Rhizosphere	MTILAVVKDVCATVGVLMPQSMFSNITGNRTMQEMLALANETAQ
Ga0132255_1047388212	3300015374	Arabidopsis Rhizosphere	VKDVCAVVGVLQPQSMFSNITGNRTMQEMLALANETAPAVAYDNRDG
Ga0190266_102939612	3300017965	Soil	MGLLSVVKDVCAVVGVLQPQSVFSNIAGNRTMQEM
Ga0190266_109147752	3300017965	Soil	MTLLSVVRDVCATVGVVQPTSIFASITGNRTMQEML
Ga0184634_102531582	3300018031	Groundwater Sediment	MTLLSVVRDVCAAVGVTLPQSVFSNITGNRTMQEMLSTANEMAQRIAYD
Ga0184634_104450032	3300018031	Groundwater Sediment	MTLLTVVRDVCAAVGVALPPTVFGGLNTNRTMQEMVALANEMSQRIAYDTRDWSAL
Ga0184635_103954781	3300018072	Groundwater Sediment	MTILAVVRDVCATVGVQVPTSVFGGIANNRTMQEMLALANEM
Ga0184624_101472321	3300018073	Groundwater Sediment	MTILAVVRDVCATVGVQVPSTVFGGIANNRTMQEMLALANEMGQRIA
Ga0184624_103078112	3300018073	Groundwater Sediment	MSLISVVRDVCAVVGVAQAASVVAAINTNRTMAEMLALANEMAQRIAY
Ga0184633_106112681	3300018077	Groundwater Sediment	MTLLSVVKDVCAVVGVAVPQSVFSNITGNRTMQEM
Ga0184639_102524861	3300018082	Groundwater Sediment	MTLLTVTREVCAAVGVSLPTSVFSGINANRTMQEMLALANEM
Ga0184628_100199624	3300018083	Groundwater Sediment	MTLLTVTRDVCEAVGVTQPTSVFSGINANRTMQEMLALANE
Ga0190271_119426031	3300018481	Soil	MTLQTVVRDVCAVVGVTLPGASIFANIATNRTMQEMVALATEMAQR
Ga0173479_104678542	3300019362	Soil	MSILSVVQDVCAVVGITTPTSVFSGITDNRTMQEIV
Ga0193741_11033552	3300019884	Soil	MSLLTVVRDVCAVVGVELPTSIFTSISANRTMQEMVALANEMAQRIAYD
Ga0210380_101165321	3300021082	Groundwater Sediment	MTLLAVVQDVCAAVGVAVPTSVFSSIAANRTMQEMLS
Ga0210380_102917272	3300021082	Groundwater Sediment	MTLLSVVRDVCAAVGVTLPQSVFSNITGNRTMQEMLSTANEM
Ga0247788_11018311	3300022901	Soil	MTLLSVVRDVCAAVGVTLPQSVFSNITGNRTMQEMLSTANEMAQRI
Ga0247766_10356173	3300022906	Plant Litter	MTLLSVVKDVCAAVGVIQPVSIFSGITGNRTMQEMLS
Ga0247766_11782682	3300022906	Plant Litter	MTLLSVVRDVCATVGVVQPTSIFSSITGNRTMQEMVALAN
Ga0247783_12432852	3300022911	Plant Litter	MSLLSVVRDVCAVVGVAMPQSVFSSLPTNRTMQEM
Ga0247751_10204891	3300023069	Soil	MTLLTVVKDVCATVGVQVPSTVFGGIANNRTMQEMLA
Ga0247762_10197173	3300023169	Plant Litter	MTLLSVVRDVCAATGVAIPQSVFSNITGNRTMQEMLSLANEMA
Ga0247784_10839771	3300023270	Plant Litter	MTLLSVTRDVCATVGVPIPQSVFTNITGNRTMQEMVSLANEMAQRIAY
Ga0247794_103501571	3300024055	Soil	MTLLSVTKDVCAAVGVLIPPTSVFTSITGNRTMQEM
Ga0247672_10317271	3300024187	Soil	MTLLSVVKDVCANVGVIVPTSVFSSITGNRTMQEMLALA
Ga0247671_10832501	3300024284	Soil	MTLLSVVKDVCAVVGVQVPTTVMTNITANRTMQEMLALANEMA
Ga0207642_105557921	3300025899	Miscanthus Rhizosphere	MTLLSVVQDVCATVGVVMPTAIFSNITGNRTMQEMVSLA
Ga0207649_115146801	3300025920	Corn Rhizosphere	MTLLSVTKDVCAAVGVLIPPTSVFISITGNRTMQEMLSLANEMAQ
Ga0207681_113711892	3300025923	Switchgrass Rhizosphere	MTLLSVVKDVCATVGVTILTSVFSNITGNRTMQEILSL
Ga0207686_104252151	3300025934	Miscanthus Rhizosphere	MTLLTVVKDVCSVVGVIQPSSVFTNITGTRTMQEMLS
Ga0207686_105792151	3300025934	Miscanthus Rhizosphere	MSLLTVVQDVCAHVGVTYPNSVFSNIASNRSMQEMLAVANEQAQR
Ga0207709_102341291	3300025935	Miscanthus Rhizosphere	MTLLSVVKDVCATVGVTIPTSVFSNITGNRTMQEML
Ga0207669_109689331	3300025937	Miscanthus Rhizosphere	MTILTVVQDVCAVVGVVVPNTLFGSIGANRTMQEMTRLANEM
Ga0207669_116632961	3300025937	Miscanthus Rhizosphere	MTILTVVKDVCAAVGVATPTSLFASIASNRTMQEMLAL
Ga0207704_106692822	3300025938	Miscanthus Rhizosphere	MTILSVVKDVCATVGVLMPQSMFSNITGNRTMQEMLALANE
Ga0207711_117605361	3300025941	Switchgrass Rhizosphere	MTLLTVVNDVCAVVGVEQTTSVFTNITNNRTMAEMLALANEMAQRIAY
Ga0209593_102374282	3300027743	Freshwater Sediment	MTLLSVVKDVCATVGVALPQSVFSNLTGNRTMQEML
Ga0265345_1012752	3300028014	Plant Litter	MTVLSVVQDVCSATGVVLPTSIFSGITGNRTMQEMLALAN
Ga0307296_108133792	3300028819	Soil	MTLLTVVRDVCATVGVTAPQSVFSNISVNRTMFEMLSLANEM
Ga0310886_107716341	3300031562	Soil	MTILAVVKDVCATVGVLTPQSMFSNITGNRTMQEMLALANET
Ga0306917_108825601	3300031719	Soil	MSLLTTIQDVCPVIGVAVPQSVFANIPANRTMQEMLALAN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F099461

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences