NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099374

Metagenome Family F099374

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099374
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 45 residues
Representative Sequence MKLFKANPAAQSEADRARDLRLTSIASRYRPRPDTAPEPQPSE
Number of Associated Samples 78
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.47 %
% of genes near scaffold ends (potentially truncated) 32.04 %
% of genes from short scaffolds (< 2000 bps) 82.52 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.194 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(21.359 % of family members)
Environment Ontology (ENVO) Unclassified
(59.223 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.874 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.99%    β-sheet: 0.00%    Coil/Unstructured: 69.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00083Sugar_tr 28.16
PF02397Bac_transf 6.80
PF07690MFS_1 4.85
PF00196GerE 4.85
PF13185GAF_2 1.94
PF00384Molybdopterin 0.97
PF03721UDPG_MGDP_dh_N 0.97
PF07589PEP-CTERM 0.97
PF00107ADH_zinc_N 0.97
PF03734YkuD 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 6.80
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.97
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.97
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.97
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.97
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.97
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.97
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.19 %
UnclassifiedrootN/A39.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_75298All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300001904|JGI24736J21556_1081993Not Available507Open in IMG/M
3300003321|soilH1_10015625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571300Open in IMG/M
3300003322|rootL2_10347456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1159Open in IMG/M
3300005093|Ga0062594_100033791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2392Open in IMG/M
3300005175|Ga0066673_10321454All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005184|Ga0066671_10806760All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005186|Ga0066676_10498357Not Available827Open in IMG/M
3300005186|Ga0066676_10690671Not Available695Open in IMG/M
3300005327|Ga0070658_10064767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00572981Open in IMG/M
3300005327|Ga0070658_10130966All Organisms → cellular organisms → Bacteria2090Open in IMG/M
3300005328|Ga0070676_10135027All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300005328|Ga0070676_10533508All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005329|Ga0070683_102143032All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005331|Ga0070670_100487751Not Available1095Open in IMG/M
3300005331|Ga0070670_100761940All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005331|Ga0070670_101413229Not Available638Open in IMG/M
3300005333|Ga0070677_10004760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00574446Open in IMG/M
3300005337|Ga0070682_100228136All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300005339|Ga0070660_100494957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE2201017Open in IMG/M
3300005339|Ga0070660_100599314Not Available921Open in IMG/M
3300005340|Ga0070689_100375391Not Available1197Open in IMG/M
3300005344|Ga0070661_100065515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae2670Open in IMG/M
3300005344|Ga0070661_100328084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1196Open in IMG/M
3300005353|Ga0070669_100486960Not Available1021Open in IMG/M
3300005355|Ga0070671_100682290Not Available890Open in IMG/M
3300005364|Ga0070673_100154793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1944Open in IMG/M
3300005364|Ga0070673_100387217All Organisms → cellular organisms → Bacteria → Proteobacteria1248Open in IMG/M
3300005364|Ga0070673_100461247Not Available1144Open in IMG/M
3300005434|Ga0070709_10020067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00573873Open in IMG/M
3300005539|Ga0068853_101193229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220735Open in IMG/M
3300005564|Ga0070664_100015768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00576185Open in IMG/M
3300005575|Ga0066702_10094390All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300005575|Ga0066702_10244057Not Available1095Open in IMG/M
3300005587|Ga0066654_10626630Not Available597Open in IMG/M
3300005616|Ga0068852_101983835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas604Open in IMG/M
3300005617|Ga0068859_101561840Not Available729Open in IMG/M
3300005834|Ga0068851_10413222All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005834|Ga0068851_10544729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220701Open in IMG/M
3300006032|Ga0066696_10195418Not Available1288Open in IMG/M
3300006046|Ga0066652_100699319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae965Open in IMG/M
3300006358|Ga0068871_100789372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria875Open in IMG/M
3300006800|Ga0066660_10078471All Organisms → cellular organisms → Bacteria2266Open in IMG/M
3300009098|Ga0105245_13072816Not Available517Open in IMG/M
3300009176|Ga0105242_10895222Not Available887Open in IMG/M
3300009177|Ga0105248_10051534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00574618Open in IMG/M
3300010044|Ga0126310_10369948All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300010397|Ga0134124_10918657Not Available883Open in IMG/M
3300012212|Ga0150985_106664187Not Available577Open in IMG/M
3300012363|Ga0137390_11616316All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012469|Ga0150984_117148225Not Available530Open in IMG/M
3300012955|Ga0164298_10522097All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300012977|Ga0134087_10832928Not Available503Open in IMG/M
3300012989|Ga0164305_11214486Not Available654Open in IMG/M
3300012989|Ga0164305_11290220Not Available637Open in IMG/M
3300013102|Ga0157371_10479379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas917Open in IMG/M
3300014745|Ga0157377_10208456Not Available1245Open in IMG/M
3300015084|Ga0167654_1009245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1703Open in IMG/M
3300015195|Ga0167658_1031522All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300015374|Ga0132255_104100999Not Available618Open in IMG/M
3300018431|Ga0066655_11386322Not Available509Open in IMG/M
3300018482|Ga0066669_12206765Not Available522Open in IMG/M
3300018920|Ga0190273_10139861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-11428Open in IMG/M
3300025315|Ga0207697_10038028All Organisms → cellular organisms → Bacteria1973Open in IMG/M
3300025315|Ga0207697_10040055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1923Open in IMG/M
3300025321|Ga0207656_10641148Not Available543Open in IMG/M
3300025321|Ga0207656_10695852All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025893|Ga0207682_10005867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae4977Open in IMG/M
3300025899|Ga0207642_10008199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00073571Open in IMG/M
3300025901|Ga0207688_10371030Not Available884Open in IMG/M
3300025903|Ga0207680_10089845All Organisms → cellular organisms → Bacteria1951Open in IMG/M
3300025904|Ga0207647_10002159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas15020Open in IMG/M
3300025904|Ga0207647_10299019All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300025909|Ga0207705_10328315All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300025909|Ga0207705_10744855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae761Open in IMG/M
3300025917|Ga0207660_10738778All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300025919|Ga0207657_10110306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2273Open in IMG/M
3300025919|Ga0207657_10137267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2000Open in IMG/M
3300025919|Ga0207657_10233049Not Available1472Open in IMG/M
3300025920|Ga0207649_10067864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2265Open in IMG/M
3300025920|Ga0207649_10082566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2084Open in IMG/M
3300025920|Ga0207649_11109002All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025925|Ga0207650_11068954All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300025929|Ga0207664_10460084All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300025932|Ga0207690_10130761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1837Open in IMG/M
3300025932|Ga0207690_10350447Not Available1167Open in IMG/M
3300025933|Ga0207706_10099456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2559Open in IMG/M
3300025938|Ga0207704_11152829Not Available660Open in IMG/M
3300025941|Ga0207711_11036743Not Available760Open in IMG/M
3300025945|Ga0207679_10608810Not Available985Open in IMG/M
3300025945|Ga0207679_11838099Not Available553Open in IMG/M
3300025949|Ga0207667_11244503Not Available722Open in IMG/M
3300026023|Ga0207677_10764740Not Available862Open in IMG/M
3300026041|Ga0207639_11679620All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300026067|Ga0207678_10394518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola1198Open in IMG/M
3300026067|Ga0207678_10873454All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300031938|Ga0308175_102158415Not Available624Open in IMG/M
3300031939|Ga0308174_11852273Not Available519Open in IMG/M
3300031996|Ga0308176_10240427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1729Open in IMG/M
3300031996|Ga0308176_11128851Not Available830Open in IMG/M
3300034268|Ga0372943_1182010Not Available512Open in IMG/M
3300034817|Ga0373948_0176303All Organisms → cellular organisms → Bacteria547Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere21.36%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere11.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere9.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.88%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.91%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.91%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.97%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2Host-AssociatedOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015084Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_012288602199352024SoilMRLFKINPPAQSEEDRARDLRLTSIASRYRVRPEMAPQSQPEPEPGA
JGI24736J21556_108199313300001904Corn RhizosphereFEKGPKMRMFKANQAAQSEADRVRDLRLTSIASRYRVRPVAASEPQPEPSE*
soilH1_1001562523300003321Sugarcane Root And Bulk SoilMRLFKANHSARSEEDRARDLRLTSIASRYRARPDAVPEPQQASS*
rootL2_1034745613300003322Sugarcane Root And Bulk SoilMRLFKANHSARSEEDRARDLRLTSIASRYRARPDPVPEPQPQASS*
Ga0062594_10003379133300005093SoilMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP*
Ga0066673_1032145423300005175SoilMRLFKANQPAQSEEDRARDLRLTSIASRHRVRPETTPAQEPSQ*
Ga0066671_1080676023300005184SoilMKLFKANAPAQSEADRARDLRLTSIASRYRSRPEAPPEPQPSASE*
Ga0066676_1049835723300005186SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRVRSDAALELQTEPQAQPEPGE*
Ga0066676_1069067113300005186SoilMRLFKANASTQSEEDRARDLRLTSIASRYRVRPQLVPETEKSD*
Ga0070658_1006476743300005327Corn RhizosphereMKLFKANQPAQSEADRARDLRLTSIASRYRSRPETVSEPQPEASQ*
Ga0070658_1013096623300005327Corn RhizosphereMRLFKANQAALSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ*
Ga0070676_1013502733300005328Miscanthus RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRPDTPPEPQPSE*
Ga0070676_1053350823300005328Miscanthus RhizosphereMRLFKVNPSAQSEEDRARDLRLTSIASRYRVRSETAPQPQPEANQ*
Ga0070683_10214303223300005329Corn RhizosphereMRLFKANHTALSEEDRARDLRLTSIASRYRTRPELAPQRDPEPEPGQ*
Ga0070670_10048775133300005331Switchgrass RhizosphereMRLFKANHTALSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ*
Ga0070670_10076194013300005331Switchgrass RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQAGQ*
Ga0070670_10141322913300005331Switchgrass RhizosphereMKLFKANQPAQSEADRARDLRLTSIASRYRSRPEAVSEQQPEASQ*
Ga0070677_1000476043300005333Miscanthus RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRSDTPPEPQPSE*
Ga0070682_10022813623300005337Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRGDAADEPQAQAGQ*
Ga0070660_10049495723300005339Corn RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGDAADEPQAQAGQ*
Ga0070660_10059931423300005339Corn RhizosphereMKLFKANQPAQSEADRARDLRLTSIASRYRSRPEAVSEPQPEASQ*
Ga0070689_10037539113300005340Switchgrass RhizosphereERGTPLMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP*
Ga0070661_10006551543300005344Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIATRYRPRSDTAPEPQPSE*
Ga0070661_10032808423300005344Corn RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQPGQ*
Ga0070669_10048696013300005353Switchgrass RhizosphereRGTPLMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP*
Ga0070671_10068229043300005355Switchgrass RhizosphereFKANPAAQSEADRARDLRLTSIASRYRPRSDTPPEPQPSE*
Ga0070673_10015479323300005364Switchgrass RhizosphereMRLFRDNPSAQSEADRARDLRLTSIASRYRPRPEAKSEPQPESGQ*
Ga0070673_10038721743300005364Switchgrass RhizosphereRRGEWSHERGTPLMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEASPEPQPDPNP*
Ga0070673_10046124743300005364Switchgrass RhizosphereMKLFKANQPAQSEADRARDLRLTSIASRYRSRPEAVSESQPEASQ*
Ga0070709_1002006743300005434Corn, Switchgrass And Miscanthus RhizosphereMRLFKANQSAQSEEDRARDLRLTSIASRYRARSGSALEPQTEPQAQPGPSE*
Ga0068853_10119322913300005539Corn RhizosphereLFKANPAAQSEADRARDLRLTSIASRYRPRGDAADEPQAQAGQ*
Ga0070664_10001576853300005564Corn RhizosphereMRLFKANQTAQSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ*
Ga0066702_1009439043300005575SoilMKLFKANQAAQSEEDRARDLRLTSIASRYRARPEAAPQPQPEPETGQ*
Ga0066702_1024405743300005575SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRVRSDAALELQTEPQAQPEAGE*
Ga0066654_1062663013300005587SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRVRSDAAPEPEPQPEPGE*
Ga0068852_10198383533300005616Corn RhizosphereAQSEADRARDLRLTSIASRYRSRPETVSEPQPEASQ*
Ga0068859_10156184023300005617Switchgrass RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRVRSETAPQPQPESNQ*
Ga0068851_1041322223300005834Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRVRSETAPQPQPEANQ*
Ga0068851_1054472943300005834Corn RhizosphereLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQPGQ*
Ga0068851_1068881413300005834Corn RhizosphereGEWFYEGGLSPMRLFKANQAALSEEDRARDLRLTSIASRYRTRPELAPQRDPEPEPGQ*
Ga0066696_1019541823300006032SoilMRLFKANQPAQSEEDRARDLRLTSIASRHRVRPETPPAQEPSQ*
Ga0066652_10069931923300006046SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRARNEAAPERPIEPQPEIPQDTSE*
Ga0068871_10078937213300006358Miscanthus RhizosphereLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQAGQ*
Ga0066660_1007847123300006800SoilMKLFKANPRVPSEEDRARDLRLTSIASRYRVRSDAALELQTEPRAQPEPGE*
Ga0105245_1307281613300009098Miscanthus RhizosphereMRLFKANYAAQSEEDRVRDLRLTSIASRYRARPDISLVPD
Ga0105242_1089522213300009176Miscanthus RhizosphereNPAAQSEADRARDLRLTSIASRYRPRPDTPAEPQSSE*
Ga0105248_1005153453300009177Switchgrass RhizosphereMKLFRDNPSAQSEADRARDLRLTSIASRYRPRPEAKSEPQPESGQ*
Ga0126310_1036994823300010044Serpentine SoilMKLFKANPAAQSEADRARDLRLTSIASRYRPRPDTAPEPQPSE*
Ga0134124_1091865723300010397Terrestrial SoilMRLFKVNPSAQSEEDRARDLRLTSIASRYRVRSETTPHPQPEPNR*
Ga0150985_10666418733300012212Avena Fatua RhizosphereMRLFKANQSAQSEEDRARDLRLTSIASRYRARNEAASERPIEPQPEIPQDTSE*
Ga0137390_1161631623300012363Vadose Zone SoilMRLFKASQPAAQSEEDRARDLRLTSIASRYRVRSDAAAPEAQPEASQ*
Ga0150984_11714822513300012469Avena Fatua RhizosphereMKLFKANASAQSEEDRARDLRLTSIASRYRVRPEPAPQPQPEASQ*
Ga0164298_1052209723300012955SoilMKLFKANPAAQSEADRARDLRLTSIASRYRPRGDAADEPQAQA
Ga0134087_1083292813300012977Grasslands SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRVRSDATLELQAEPQAQPEPGE*
Ga0164305_1121448623300012989SoilMKLFKANSPAQSEADRARDLRLTSIASRYRSRPEAVSEPQPEASQ*
Ga0164305_1129022013300012989SoilMRLFKANQSYQSEEDRARDARLTHIASRYRARPSSDMP
Ga0157371_1047937913300013102Corn RhizosphereQSEADRARDLRLTSIASRYRPRGEAAAEPQAQAGQ*
Ga0157377_1020845643300014745Miscanthus RhizosphereSHERGTPLMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP*
Ga0167654_100924513300015084Glacier Forefield SoilMRLFKANQPAQSEEDRARDLRLTSIASRFRVRNDATPQ
Ga0167658_103152253300015195Glacier Forefield SoilMRLFKANQPAQSEEDRARDLRLTSIASRYRVRNDATPQPQGEPEPASDSASDWGQ*
Ga0132255_10410099913300015374Arabidopsis RhizospherePSAQSEADRARDLRLTSIASRYRPRPEAKSEPQPESGQ*
Ga0066655_1138632223300018431Grasslands SoilMRLFKANAFAQSEEDRARDLRLTSIASRYRVRPQLVPETEKSD
Ga0066669_1220676523300018482Grasslands SoilMRLFKANQPAQSEEDRARDLRLTSIASRHRVRPETTPAQEPSQ
Ga0190273_1013986113300018920SoilHPAQSEADRARDLRLTSIASRYRPRPELHAGEAAPAPQTEPPEPAE
Ga0207697_1003802843300025315Corn, Switchgrass And Miscanthus RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRPDTPPEPQPSE
Ga0207697_1004005523300025315Corn, Switchgrass And Miscanthus RhizosphereMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP
Ga0207656_1064114813300025321Corn RhizosphereGEWFYEGGLSPMRLFKANQAALSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ
Ga0207656_1069585223300025321Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQAGQ
Ga0207682_1000586723300025893Miscanthus RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRSDTPPEPQPSE
Ga0207642_1000819933300025899Miscanthus RhizosphereMRLFKVNPSAQSEEDRARDLRLTSIASRYRVRSETAPQPQPEANQ
Ga0207688_1037103043300025901Corn, Switchgrass And Miscanthus RhizospherePMKLFKANPAAQSEADRARDLRLTSIASRYRPRSDTPPEPQPSE
Ga0207680_1008984543300025903Switchgrass RhizosphereMKLFRDNPSAQSEADRARDLRLTSIASRYRPRPEAKSEPQPESGQ
Ga0207647_10002159163300025904Corn RhizosphereMRLFKANPSAQSEADRARDLRLTSIASRYRVRSEITPQPQPEPNQ
Ga0207647_1029901923300025904Corn RhizosphereMRLFKANHTALSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ
Ga0207705_1032831523300025909Corn RhizosphereMRLFKANQTALSEEDRARDLRLTSIASRYRTRPELAPQRDPEPEPGQ
Ga0207705_1074485523300025909Corn RhizosphereMKLFKANQPAQSEADRARDLRLTSIASRYRSRPEAVSESQPEASQ
Ga0207660_1073877813300025917Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRSDT
Ga0207657_1011030633300025919Corn RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGDAADEPQAQAGQ
Ga0207657_1013726723300025919Corn RhizosphereMKLFKANQPAQSEADRARDLRLTSIASRYRSRPEAVSEPQPEASQ
Ga0207657_1023304923300025919Corn RhizosphereMRLFKANHTALSEEDRARDLRLTSIASRYRTRPELAPQRDPEPEPGQ
Ga0207649_1006786413300025920Corn RhizosphereANPAAQSEADRARDLRLTSIASRYRPRSDTPPEPQPSE
Ga0207649_1008256633300025920Corn RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQAGQ
Ga0207649_1110900223300025920Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIATRYRPRSDTAPEPQPSE
Ga0207650_1106895413300025925Switchgrass RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQA
Ga0207664_1046008413300025929Agricultural SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRVRSAS
Ga0207690_1013076163300025932Corn RhizosphereGGHEPMRLFKPNPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQAGQ
Ga0207690_1035044723300025932Corn RhizosphereMRLFKANQAALSEEDRARDLRLTSIASRYRTRPELAPQRDPEPEPGQ
Ga0207706_1009945653300025933Corn RhizosphereMRLFKANQTALSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ
Ga0207704_1115282913300025938Miscanthus RhizosphereSAQSEEDRARDLRLTSIASRYRVRSETAPQPQPEANQ
Ga0207711_1103674323300025941Switchgrass RhizosphereDNPSAQSEADRARDLRLTSIASRYRPRPEAKSEPQPESGQ
Ga0207679_1060881033300025945Corn RhizosphereMRLFKANQTAQSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ
Ga0207679_1183809913300025945Corn RhizospherePPMKLFKANQPAQSEADRARDLRLTSIASRYRSRPEAGSEPQPEASQ
Ga0207667_1124450323300025949Corn RhizosphereMKLFKANPAAQSEADRARDLRLTSIASRYRPRPDTTPEPHPSE
Ga0207677_1076474013300026023Miscanthus RhizosphereRGEWSHERGTPLMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP
Ga0207639_1167962023300026041Corn RhizosphereMRLFKANPAAQSEADRARDLRLTSIASRYRPRGDAADEPQ
Ga0207678_1039451813300026067Corn RhizosphereALSEEDRARDLRLTSIASRYRTRPELAPQRDPQPEPGQ
Ga0207678_1087345413300026067Corn RhizospherePLMRLFRDNPPARSEADRARDLRLTSIASRYRPRPEAASEPQPEANP
Ga0308175_10215841523300031938SoilMRLFKANQGAQSEEDRARDLRLTSIASRYRVRAETAPQPQPEPEPGP
Ga0308174_1185227313300031939SoilMRLFKANQSAQSEEDRARDLRLTSIASRYRVRGDAAPQPQGEPEPASDSTSDWGE
Ga0308176_1024042753300031996SoilMRLFKANPAAQSEADRARDLRLTSIASRYRPRGEAAAEPQAQPGQ
Ga0308176_1112885123300031996SoilMKLFKADQSAQSEEDRARDMRLTSIASRYRVRPDAAPEPQPQPEPGQ
Ga0372943_1182010_183_3143300034268SoilMRLFKANPSAQSEEDRARDLRLTSIASRYRVRPQLVPETEKSD
Ga0373948_0176303_294_4313300034817Rhizosphere SoilMKLFKANPPAQSEADRARDLRLTSIASRYRSRPEAVSEPQQEASH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.