NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099365

Metagenome / Metatranscriptome Family F099365

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099365
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 49 residues
Representative Sequence MLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Number of Associated Samples 96
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.97 %
% of genes near scaffold ends (potentially truncated) 99.03 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.058 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.388 % of family members)
Environment Ontology (ENVO) Unclassified
(28.155 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.864 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00069Pkinase 66.99
PF07714PK_Tyr_Ser-Thr 13.59
PF14332DUF4388 1.94
PF02423OCD_Mu_crystall 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 322.33
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.06 %
UnclassifiedrootN/A1.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_120265071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales957Open in IMG/M
3300004047|Ga0055499_10049905All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300004157|Ga0062590_102613567All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005329|Ga0070683_102394882All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005330|Ga0070690_100014583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4664Open in IMG/M
3300005331|Ga0070670_102107695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales520Open in IMG/M
3300005334|Ga0068869_100725114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales849Open in IMG/M
3300005367|Ga0070667_101608698All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium611Open in IMG/M
3300005406|Ga0070703_10215607All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005438|Ga0070701_11218141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales535Open in IMG/M
3300005458|Ga0070681_10704274Not Available926Open in IMG/M
3300005458|Ga0070681_10891065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales808Open in IMG/M
3300005466|Ga0070685_10233524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1211Open in IMG/M
3300005543|Ga0070672_100275181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1422Open in IMG/M
3300005546|Ga0070696_101234356All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005602|Ga0070762_10244275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1114Open in IMG/M
3300005834|Ga0068851_10306125All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005842|Ga0068858_101031363All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium806Open in IMG/M
3300006358|Ga0068871_101969754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales556Open in IMG/M
3300006794|Ga0066658_10292793All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300006954|Ga0079219_11379009All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium628Open in IMG/M
3300009094|Ga0111539_12264092All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium630Open in IMG/M
3300009176|Ga0105242_11042008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium828Open in IMG/M
3300009176|Ga0105242_12274887All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium588Open in IMG/M
3300009545|Ga0105237_10926839Not Available878Open in IMG/M
3300010333|Ga0134080_10687592All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium506Open in IMG/M
3300010366|Ga0126379_13279676All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300010371|Ga0134125_11727751All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium681Open in IMG/M
3300010397|Ga0134124_10329418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1432Open in IMG/M
3300010399|Ga0134127_10614677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1117Open in IMG/M
3300010400|Ga0134122_11045690All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium804Open in IMG/M
3300010401|Ga0134121_11141764All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium775Open in IMG/M
3300010403|Ga0134123_12636033All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium570Open in IMG/M
3300010867|Ga0126347_1279310All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium618Open in IMG/M
3300010869|Ga0126359_1140094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1203Open in IMG/M
3300011445|Ga0137427_10032293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2056Open in IMG/M
3300012232|Ga0137435_1210301All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium595Open in IMG/M
3300012898|Ga0157293_10062096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium865Open in IMG/M
3300012899|Ga0157299_10342288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300012902|Ga0157291_10192406All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium640Open in IMG/M
3300012904|Ga0157282_10210351All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium634Open in IMG/M
3300012910|Ga0157308_10164545All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium720Open in IMG/M
3300012984|Ga0164309_11521393All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium573Open in IMG/M
3300013105|Ga0157369_10757886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium998Open in IMG/M
3300013296|Ga0157374_11192282All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium783Open in IMG/M
3300013297|Ga0157378_11735523All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium672Open in IMG/M
3300013308|Ga0157375_10865710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1049Open in IMG/M
3300013308|Ga0157375_12288546All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300014878|Ga0180065_1094004All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium680Open in IMG/M
3300014969|Ga0157376_12261791All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium583Open in IMG/M
3300014969|Ga0157376_12607487All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium545Open in IMG/M
3300015245|Ga0137409_10149417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2138Open in IMG/M
3300015372|Ga0132256_100594143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1221Open in IMG/M
3300015374|Ga0132255_100366555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2090Open in IMG/M
3300016270|Ga0182036_11324165All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium601Open in IMG/M
3300018000|Ga0184604_10364223All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium515Open in IMG/M
3300018060|Ga0187765_11099246All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300019876|Ga0193703_1073308All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium505Open in IMG/M
3300020005|Ga0193697_1031838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1318Open in IMG/M
3300021180|Ga0210396_10936905All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300021402|Ga0210385_11069338All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium620Open in IMG/M
3300021404|Ga0210389_10708618All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium788Open in IMG/M
3300021475|Ga0210392_10324595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1109Open in IMG/M
3300024224|Ga0247673_1019429All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium903Open in IMG/M
3300024251|Ga0247679_1022425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1071Open in IMG/M
3300025912|Ga0207707_10219061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1657Open in IMG/M
3300025912|Ga0207707_10669393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium874Open in IMG/M
3300025925|Ga0207650_11283414All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300025930|Ga0207701_10666989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300025931|Ga0207644_10845064All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium766Open in IMG/M
3300025935|Ga0207709_11178755All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium631Open in IMG/M
3300025944|Ga0207661_10713232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium923Open in IMG/M
3300025944|Ga0207661_11031601All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium757Open in IMG/M
3300026078|Ga0207702_10149465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2123Open in IMG/M
3300026078|Ga0207702_11134204All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium776Open in IMG/M
3300026215|Ga0209849_1057442All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium682Open in IMG/M
3300027867|Ga0209167_10111306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1410Open in IMG/M
3300027884|Ga0209275_10099719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1485Open in IMG/M
3300028072|Ga0247675_1046986All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium639Open in IMG/M
3300028592|Ga0247822_11090440All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium663Open in IMG/M
3300031344|Ga0265316_10017045All Organisms → cellular organisms → Bacteria6288Open in IMG/M
3300031366|Ga0307506_10307819All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium622Open in IMG/M
3300031546|Ga0318538_10019205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sorangiineae incertae sedis → Minicystis → Minicystis rosea3017Open in IMG/M
3300031572|Ga0318515_10374151All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium763Open in IMG/M
3300031668|Ga0318542_10338296All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium773Open in IMG/M
3300031680|Ga0318574_10789148All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium557Open in IMG/M
3300031747|Ga0318502_10652281All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium635Open in IMG/M
3300031765|Ga0318554_10796504All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium528Open in IMG/M
3300031782|Ga0318552_10083586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1559Open in IMG/M
3300031793|Ga0318548_10679170All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031798|Ga0318523_10211072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium970Open in IMG/M
3300031819|Ga0318568_10498705All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium759Open in IMG/M
3300031854|Ga0310904_10589508All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300031890|Ga0306925_10808301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium972Open in IMG/M
3300031908|Ga0310900_10967051All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300031938|Ga0308175_101951765All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium658Open in IMG/M
3300031944|Ga0310884_10662531All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300031996|Ga0308176_12402482All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium562Open in IMG/M
3300032025|Ga0318507_10399678All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium598Open in IMG/M
3300032043|Ga0318556_10648087All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium550Open in IMG/M
3300032052|Ga0318506_10539452All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria517Open in IMG/M
3300032067|Ga0318524_10296810All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium836Open in IMG/M
3300032211|Ga0310896_10801506All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium539Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.80%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere6.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.94%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.94%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300024224Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_12026507123300002568SoilEGKRILSTTAATEESQARARRAAYRTLELAADMNEPIQLRKILLKKR*
Ga0055499_1004990513300004047Natural And Restored WetlandsQEIVGEERRYYEDGRRMLIAAASAEEAQARARRAAYRTLELASETAEPLQLRRALGGRRR
Ga0062590_10261356723300004157SoilIMTQERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0070683_10239488213300005329Corn RhizosphereSYYDLGKRLLIEATASEESQARARRAAYRTLELAGEGVEPNQLRKAFGKRRPLV*
Ga0070690_10001458343300005330Switchgrass RhizosphereQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGRRR*
Ga0070670_10210769513300005331Switchgrass RhizosphereEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0068869_10072511423300005334Miscanthus RhizosphereRYYEQGKQMLVAAVAIEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0070667_10160869823300005367Switchgrass RhizosphereLVAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0070703_1021560713300005406Corn, Switchgrass And Miscanthus RhizosphereLIAATTTEEAQARARRAAYRTLELAGETAEPLQLRRALGRRR*
Ga0070701_1121814113300005438Corn, Switchgrass And Miscanthus RhizosphereYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0070681_1070427413300005458Corn RhizosphereYETGKAMLVVAVASEESQARARRSAYRTLELAGETVEPLQLRKALGKRR*
Ga0070681_1089106513300005458Corn RhizosphereEGRLMLIASATAEESQARARRAAYRTLELAGEIVEPLALRRSLGRRR*
Ga0070685_1023352423300005466Switchgrass RhizosphereRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0070672_10027518113300005543Miscanthus RhizosphereTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0070696_10123435613300005546Corn, Switchgrass And Miscanthus RhizosphereYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0070762_1024427523300005602SoilGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR*
Ga0068851_1030612523300005834Corn RhizosphereVEMVGEERGYYELGKRLLVEATASEESQARARRAAYRTLELAGEGVEPNQLRKAFGKRRPLV*
Ga0068858_10103136323300005842Switchgrass RhizosphereTEESQARARRAAYRTLELAGETVEPLQLRKALGRRR*
Ga0068871_10196975413300006358Miscanthus RhizosphereSARLLAEISDEERRYYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0066658_1029279323300006794SoilMTQERRYYETGKAMLVAAVVSEESQARARRAAYRTLELAGETVEPLQLRKALGRRR*
Ga0079219_1137900923300006954Agricultural SoilVGVTASEESQARARRSAYRTLELATEMSEPLQLRKAMAKRR*
Ga0111539_1226409213300009094Populus RhizosphereERGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0105242_1104200823300009176Miscanthus RhizosphereAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0105242_1227488723300009176Miscanthus RhizosphereGVEIMTQERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0105237_1092683913300009545Corn RhizosphereTILTSERRYYEEGKRLLAQVATNEESQARGRRSCYRTLELATEMVEPLALRKLLPKKR*
Ga0134080_1068759223300010333Grasslands SoilGKQILVAAVATEESQARARRAAYRTLELAGETLEPLQLRKALGKRR*
Ga0126379_1327967623300010366Tropical Forest SoilLVASAVNEESQARARRSAYRTLELAGEMAEPLQLRKVLPKRR*
Ga0134125_1172775123300010371Terrestrial SoilGAEIAEEERRYYEEGQRLLVGATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0134124_1032941823300010397Terrestrial SoilRYYEEGQRLLVAATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRK*
Ga0134127_1061467723300010399Terrestrial SoilATNEESQARGRRSAYRTLELANEMMEPLALRKILPKKR*
Ga0134122_1104569023300010400Terrestrial SoilAATEESQARARRAAYRTLELVAEMHEPMQLRKILLKRR*
Ga0134121_1114176413300010401Terrestrial SoilEESQARARRAAYRTLELAGETVEPLALRKTLGKRK*
Ga0134123_1263603313300010403Terrestrial SoilVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0126347_127931023300010867Boreal Forest SoilDDLLSQERRYYEEGKGLLALVALNEESQARGRRSAYRTLELATEATEPLQLRKLLPKKR*
Ga0126359_114009423300010869Boreal Forest SoilRYYEEGKRMLIAVTTTEESQARARRSAYRTLELAGETVEPLALRKTLGKRR*
Ga0137427_1003229313300011445SoilMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRRSG*
Ga0137435_121030123300012232SoilATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0157293_1006209613300012898SoilLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0157299_1034228823300012899SoilGVEIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0157291_1019240613300012902SoilEIMTQERRYYELGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRRSG
Ga0157282_1021035123300012904SoilVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRRSG*
Ga0157308_1016454513300012910SoilMLVAAVASEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0164309_1152139323300012984SoilLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0157369_1075788613300013105Corn RhizosphereEESQARARRAAYRTLELAGETVEPLALRKTLGKRR*
Ga0157374_1119228223300013296Miscanthus RhizosphereSASTEESQARARRAAYRTLELAADMHEPIQLRKILLKKR*
Ga0157378_1173552313300013297Miscanthus RhizosphereEESQARARRAAYRTLELAADMNEPIQLRKILLKKR*
Ga0157375_1086571013300013308Miscanthus RhizosphereERRYYEEGQRLLVAATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRK*
Ga0157375_1228854613300013308Miscanthus RhizosphereATNEESQARGRRSAYRTLELATEMAEPLALRKLLPKRR*
Ga0180065_109400423300014878SoilRYYEQGKQMLVAAVASEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0157376_1226179113300014969Miscanthus RhizosphereRRYYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0157376_1260748713300014969Miscanthus RhizosphereDEERRYYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0137409_1014941713300015245Vadose Zone SoilQVALNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKKR*
Ga0132256_10059414313300015372Arabidopsis RhizosphereRRYYEQGKQMLVASVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR*
Ga0132255_10036655513300015374Arabidopsis RhizosphereIMGQERRYYESGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR*
Ga0182036_1132416513300016270SoilLLGVELLGEERRYYEEGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0184604_1036422313300018000Groundwater SedimentVAAVTTEESQARARRAAYRTLELAGETAEPLQLRKALGRRR
Ga0187765_1109924623300018060Tropical PeatlandALVASASNEESQARARRSAYRTLELAGEMAEPLQIRKALPKRR
Ga0193703_107330823300019876SoilAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR
Ga0193697_103183813300020005SoilTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR
Ga0210396_1093690513300021180SoilSTDFLDEERRYYDEGRRMLIASTATEESQARARRAAYRTLELAGETVEPLQLRKTLGKRR
Ga0210385_1106933823300021402SoilGLLASVALNEESQARGRRSAYRTLELATEATEPLQLRKLLPKRR
Ga0210389_1070861813300021404SoilRLLVGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0210392_1032459523300021475SoilKGLLASVALNEESQARGRRSAYRTLELATEATEPLQLRKLLPKKR
Ga0247673_101942913300024224SoilYEQGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0247679_102242513300024251SoilMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0207707_1021906123300025912Corn RhizosphereRYYETGKAMLVVAVASEESQARARRSAYRTLELAGETVEPLQLRKALGKRR
Ga0207707_1066939323300025912Corn RhizosphereDEGRLMLIASATAEESQARARRAAYRTLELAGEIVEPLALRRSLGRRR
Ga0207650_1128341413300025925Switchgrass RhizosphereLGVDMLSEERRYYELGKRMLTAVATTEESQARARRAAYRTLDLAGETAEPLQLRKALGKR
Ga0207701_1066698913300025930Corn, Switchgrass And Miscanthus RhizosphereERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR
Ga0207644_1084506413300025931Switchgrass RhizosphereLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0207709_1117875523300025935Miscanthus RhizosphereQERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0207661_1071323213300025944Corn RhizosphereYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0207661_1103160123300025944Corn RhizosphereEEGKRILSATAATEESQARARRAAYRTLELAGDMNEPIQLRKILLKKR
Ga0207702_1014946523300026078Corn RhizosphereTDMVAEERRYYDEGRVLLTGAATTEESQARGRRAAYRTLELAGETVEPLALRRSLGRRR
Ga0207702_1113420423300026078Corn RhizosphereLRLLVGATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0209849_105744213300026215SoilSLRYYEEGRLMLAAVATNEESQARGRRSAYRTLELATEMVEPLQLRKLLRKRR
Ga0209167_1011130623300027867Surface SoilEGLRLLVGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0209275_1009971923300027884SoilGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0247675_104698613300028072SoilAATEESQARARRAAYRTLELAGDMNEPIQLRKILLKKR
Ga0247822_1109044013300028592SoilQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGRRR
Ga0265316_1001704573300031344RhizosphereEEGKRLLTAVALNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKKR
Ga0307506_1030781913300031366SoilQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR
Ga0318538_1001920533300031546SoilIVEEERRYYEEGMRLLIGATATEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0318515_1037415113300031572SoilYYEEGMRLLIGATATEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0318542_1033829623300031668SoilYEEGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0318574_1078914813300031680SoilTEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0318502_1065228113300031747SoilQERRYYEEGKRLLTAAATNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKKR
Ga0318554_1079650423300031765SoilLSEERRYYDEGKRMLIAAAGVEESQARARRAAYRTLELAMETAEPLQLRKALGKRR
Ga0318552_1008358613300031782SoilGTEESQARARRAAFRTLELAGETVEPLQLRKAFGRRRSLV
Ga0318548_1067917013300031793SoilVEEERRYYEEGMRLLIGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0318523_1021107223300031798SoilGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0318568_1049870513300031819SoilLGVEILGEERRYYEDGKQLLTAAAGTEESQARARRAAFRTLELAGETVEPLQLRKAFGRRRSLV
Ga0310904_1058950813300031854SoilRLLGVEIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR
Ga0306925_1080830113300031890SoilAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0310900_1096705113300031908SoilIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR
Ga0308175_10195176523300031938SoilLRLLVGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR
Ga0310884_1066253113300031944SoilRLLGVEIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR
Ga0308176_1240248213300031996SoilRLLGTDMVADERRYYDEGRVLLTGAATTEESQARGRRSAYRTLELAGETVEPLALRRSLGRRR
Ga0318507_1039967813300032025SoilEERRYYEEGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV
Ga0318556_1064808723300032043SoilLLTQERRYYEEGKRLLMAAAQNEESQARGRRSAYRTLELADDMVEPLQLRKLLPKKR
Ga0318506_1053945213300032052SoilLLTAVAVNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKRR
Ga0318524_1029681023300032067SoilTLLTQERRYYEEGKRLLMAAAQNEESQARGRRSAYRTLELADDMVEPLQLRKLLPKRR
Ga0310896_1080150613300032211SoilKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.