| Basic Information | |
|---|---|
| Family ID | F099365 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 99.03 % |
| % of genes from short scaffolds (< 2000 bps) | 93.20 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.058 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.388 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.155 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.864 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 66.99 |
| PF07714 | PK_Tyr_Ser-Thr | 13.59 |
| PF14332 | DUF4388 | 1.94 |
| PF02423 | OCD_Mu_crystall | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 322.33 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.06 % |
| Unclassified | root | N/A | 1.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120265071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 957 | Open in IMG/M |
| 3300004047|Ga0055499_10049905 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300004157|Ga0062590_102613567 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005329|Ga0070683_102394882 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005330|Ga0070690_100014583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4664 | Open in IMG/M |
| 3300005331|Ga0070670_102107695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 520 | Open in IMG/M |
| 3300005334|Ga0068869_100725114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 849 | Open in IMG/M |
| 3300005367|Ga0070667_101608698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 611 | Open in IMG/M |
| 3300005406|Ga0070703_10215607 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005438|Ga0070701_11218141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 535 | Open in IMG/M |
| 3300005458|Ga0070681_10704274 | Not Available | 926 | Open in IMG/M |
| 3300005458|Ga0070681_10891065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 808 | Open in IMG/M |
| 3300005466|Ga0070685_10233524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1211 | Open in IMG/M |
| 3300005543|Ga0070672_100275181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1422 | Open in IMG/M |
| 3300005546|Ga0070696_101234356 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005602|Ga0070762_10244275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300005834|Ga0068851_10306125 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005842|Ga0068858_101031363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 806 | Open in IMG/M |
| 3300006358|Ga0068871_101969754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 556 | Open in IMG/M |
| 3300006794|Ga0066658_10292793 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300006954|Ga0079219_11379009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 628 | Open in IMG/M |
| 3300009094|Ga0111539_12264092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 630 | Open in IMG/M |
| 3300009176|Ga0105242_11042008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300009176|Ga0105242_12274887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 588 | Open in IMG/M |
| 3300009545|Ga0105237_10926839 | Not Available | 878 | Open in IMG/M |
| 3300010333|Ga0134080_10687592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
| 3300010366|Ga0126379_13279676 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010371|Ga0134125_11727751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 681 | Open in IMG/M |
| 3300010397|Ga0134124_10329418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1432 | Open in IMG/M |
| 3300010399|Ga0134127_10614677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1117 | Open in IMG/M |
| 3300010400|Ga0134122_11045690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 804 | Open in IMG/M |
| 3300010401|Ga0134121_11141764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 775 | Open in IMG/M |
| 3300010403|Ga0134123_12636033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 570 | Open in IMG/M |
| 3300010867|Ga0126347_1279310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 618 | Open in IMG/M |
| 3300010869|Ga0126359_1140094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300011445|Ga0137427_10032293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2056 | Open in IMG/M |
| 3300012232|Ga0137435_1210301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 595 | Open in IMG/M |
| 3300012898|Ga0157293_10062096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300012899|Ga0157299_10342288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300012902|Ga0157291_10192406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 640 | Open in IMG/M |
| 3300012904|Ga0157282_10210351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 634 | Open in IMG/M |
| 3300012910|Ga0157308_10164545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 720 | Open in IMG/M |
| 3300012984|Ga0164309_11521393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 573 | Open in IMG/M |
| 3300013105|Ga0157369_10757886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 998 | Open in IMG/M |
| 3300013296|Ga0157374_11192282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 783 | Open in IMG/M |
| 3300013297|Ga0157378_11735523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 672 | Open in IMG/M |
| 3300013308|Ga0157375_10865710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1049 | Open in IMG/M |
| 3300013308|Ga0157375_12288546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300014878|Ga0180065_1094004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 680 | Open in IMG/M |
| 3300014969|Ga0157376_12261791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 583 | Open in IMG/M |
| 3300014969|Ga0157376_12607487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 545 | Open in IMG/M |
| 3300015245|Ga0137409_10149417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2138 | Open in IMG/M |
| 3300015372|Ga0132256_100594143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1221 | Open in IMG/M |
| 3300015374|Ga0132255_100366555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2090 | Open in IMG/M |
| 3300016270|Ga0182036_11324165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 601 | Open in IMG/M |
| 3300018000|Ga0184604_10364223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 515 | Open in IMG/M |
| 3300018060|Ga0187765_11099246 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300019876|Ga0193703_1073308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 505 | Open in IMG/M |
| 3300020005|Ga0193697_1031838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1318 | Open in IMG/M |
| 3300021180|Ga0210396_10936905 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300021402|Ga0210385_11069338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 620 | Open in IMG/M |
| 3300021404|Ga0210389_10708618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 788 | Open in IMG/M |
| 3300021475|Ga0210392_10324595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300024224|Ga0247673_1019429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 903 | Open in IMG/M |
| 3300024251|Ga0247679_1022425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300025912|Ga0207707_10219061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1657 | Open in IMG/M |
| 3300025912|Ga0207707_10669393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300025925|Ga0207650_11283414 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300025930|Ga0207701_10666989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300025931|Ga0207644_10845064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 766 | Open in IMG/M |
| 3300025935|Ga0207709_11178755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 631 | Open in IMG/M |
| 3300025944|Ga0207661_10713232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300025944|Ga0207661_11031601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 757 | Open in IMG/M |
| 3300026078|Ga0207702_10149465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2123 | Open in IMG/M |
| 3300026078|Ga0207702_11134204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 776 | Open in IMG/M |
| 3300026215|Ga0209849_1057442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 682 | Open in IMG/M |
| 3300027867|Ga0209167_10111306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1410 | Open in IMG/M |
| 3300027884|Ga0209275_10099719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1485 | Open in IMG/M |
| 3300028072|Ga0247675_1046986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 639 | Open in IMG/M |
| 3300028592|Ga0247822_11090440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 663 | Open in IMG/M |
| 3300031344|Ga0265316_10017045 | All Organisms → cellular organisms → Bacteria | 6288 | Open in IMG/M |
| 3300031366|Ga0307506_10307819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 622 | Open in IMG/M |
| 3300031546|Ga0318538_10019205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sorangiineae incertae sedis → Minicystis → Minicystis rosea | 3017 | Open in IMG/M |
| 3300031572|Ga0318515_10374151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 763 | Open in IMG/M |
| 3300031668|Ga0318542_10338296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 773 | Open in IMG/M |
| 3300031680|Ga0318574_10789148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 557 | Open in IMG/M |
| 3300031747|Ga0318502_10652281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 635 | Open in IMG/M |
| 3300031765|Ga0318554_10796504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 528 | Open in IMG/M |
| 3300031782|Ga0318552_10083586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1559 | Open in IMG/M |
| 3300031793|Ga0318548_10679170 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031798|Ga0318523_10211072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300031819|Ga0318568_10498705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 759 | Open in IMG/M |
| 3300031854|Ga0310904_10589508 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300031890|Ga0306925_10808301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300031908|Ga0310900_10967051 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031938|Ga0308175_101951765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 658 | Open in IMG/M |
| 3300031944|Ga0310884_10662531 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031996|Ga0308176_12402482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 562 | Open in IMG/M |
| 3300032025|Ga0318507_10399678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 598 | Open in IMG/M |
| 3300032043|Ga0318556_10648087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 550 | Open in IMG/M |
| 3300032052|Ga0318506_10539452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 517 | Open in IMG/M |
| 3300032067|Ga0318524_10296810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 836 | Open in IMG/M |
| 3300032211|Ga0310896_10801506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1202650712 | 3300002568 | Soil | EGKRILSTTAATEESQARARRAAYRTLELAADMNEPIQLRKILLKKR* |
| Ga0055499_100499051 | 3300004047 | Natural And Restored Wetlands | QEIVGEERRYYEDGRRMLIAAASAEEAQARARRAAYRTLELASETAEPLQLRRALGGRRR |
| Ga0062590_1026135672 | 3300004157 | Soil | IMTQERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0070683_1023948821 | 3300005329 | Corn Rhizosphere | SYYDLGKRLLIEATASEESQARARRAAYRTLELAGEGVEPNQLRKAFGKRRPLV* |
| Ga0070690_1000145834 | 3300005330 | Switchgrass Rhizosphere | QMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGRRR* |
| Ga0070670_1021076951 | 3300005331 | Switchgrass Rhizosphere | EQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0068869_1007251142 | 3300005334 | Miscanthus Rhizosphere | RYYEQGKQMLVAAVAIEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0070667_1016086982 | 3300005367 | Switchgrass Rhizosphere | LVAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0070703_102156071 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAATTTEEAQARARRAAYRTLELAGETAEPLQLRRALGRRR* |
| Ga0070701_112181411 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | YEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0070681_107042741 | 3300005458 | Corn Rhizosphere | YETGKAMLVVAVASEESQARARRSAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0070681_108910651 | 3300005458 | Corn Rhizosphere | EGRLMLIASATAEESQARARRAAYRTLELAGEIVEPLALRRSLGRRR* |
| Ga0070685_102335242 | 3300005466 | Switchgrass Rhizosphere | RYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0070672_1002751811 | 3300005543 | Miscanthus Rhizosphere | TEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0070696_1012343561 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | YEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0070762_102442752 | 3300005602 | Soil | GATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR* |
| Ga0068851_103061252 | 3300005834 | Corn Rhizosphere | VEMVGEERGYYELGKRLLVEATASEESQARARRAAYRTLELAGEGVEPNQLRKAFGKRRPLV* |
| Ga0068858_1010313632 | 3300005842 | Switchgrass Rhizosphere | TEESQARARRAAYRTLELAGETVEPLQLRKALGRRR* |
| Ga0068871_1019697541 | 3300006358 | Miscanthus Rhizosphere | SARLLAEISDEERRYYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0066658_102927932 | 3300006794 | Soil | MTQERRYYETGKAMLVAAVVSEESQARARRAAYRTLELAGETVEPLQLRKALGRRR* |
| Ga0079219_113790092 | 3300006954 | Agricultural Soil | VGVTASEESQARARRSAYRTLELATEMSEPLQLRKAMAKRR* |
| Ga0111539_122640921 | 3300009094 | Populus Rhizosphere | ERGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0105242_110420082 | 3300009176 | Miscanthus Rhizosphere | AAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0105242_122748872 | 3300009176 | Miscanthus Rhizosphere | GVEIMTQERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0105237_109268391 | 3300009545 | Corn Rhizosphere | TILTSERRYYEEGKRLLAQVATNEESQARGRRSCYRTLELATEMVEPLALRKLLPKKR* |
| Ga0134080_106875922 | 3300010333 | Grasslands Soil | GKQILVAAVATEESQARARRAAYRTLELAGETLEPLQLRKALGKRR* |
| Ga0126379_132796762 | 3300010366 | Tropical Forest Soil | LVASAVNEESQARARRSAYRTLELAGEMAEPLQLRKVLPKRR* |
| Ga0134125_117277512 | 3300010371 | Terrestrial Soil | GAEIAEEERRYYEEGQRLLVGATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0134124_103294182 | 3300010397 | Terrestrial Soil | RYYEEGQRLLVAATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRK* |
| Ga0134127_106146772 | 3300010399 | Terrestrial Soil | ATNEESQARGRRSAYRTLELANEMMEPLALRKILPKKR* |
| Ga0134122_110456902 | 3300010400 | Terrestrial Soil | AATEESQARARRAAYRTLELVAEMHEPMQLRKILLKRR* |
| Ga0134121_111417641 | 3300010401 | Terrestrial Soil | EESQARARRAAYRTLELAGETVEPLALRKTLGKRK* |
| Ga0134123_126360331 | 3300010403 | Terrestrial Soil | VATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0126347_12793102 | 3300010867 | Boreal Forest Soil | DDLLSQERRYYEEGKGLLALVALNEESQARGRRSAYRTLELATEATEPLQLRKLLPKKR* |
| Ga0126359_11400942 | 3300010869 | Boreal Forest Soil | RYYEEGKRMLIAVTTTEESQARARRSAYRTLELAGETVEPLALRKTLGKRR* |
| Ga0137427_100322931 | 3300011445 | Soil | MLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRRSG* |
| Ga0137435_12103012 | 3300012232 | Soil | ATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0157293_100620961 | 3300012898 | Soil | LVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0157299_103422882 | 3300012899 | Soil | GVEIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0157291_101924061 | 3300012902 | Soil | EIMTQERRYYELGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRRSG |
| Ga0157282_102103512 | 3300012904 | Soil | VAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRRSG* |
| Ga0157308_101645451 | 3300012910 | Soil | MLVAAVASEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0164309_115213932 | 3300012984 | Soil | LAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0157369_107578861 | 3300013105 | Corn Rhizosphere | EESQARARRAAYRTLELAGETVEPLALRKTLGKRR* |
| Ga0157374_111922822 | 3300013296 | Miscanthus Rhizosphere | SASTEESQARARRAAYRTLELAADMHEPIQLRKILLKKR* |
| Ga0157378_117355231 | 3300013297 | Miscanthus Rhizosphere | EESQARARRAAYRTLELAADMNEPIQLRKILLKKR* |
| Ga0157375_108657101 | 3300013308 | Miscanthus Rhizosphere | ERRYYEEGQRLLVAATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRK* |
| Ga0157375_122885461 | 3300013308 | Miscanthus Rhizosphere | ATNEESQARGRRSAYRTLELATEMAEPLALRKLLPKRR* |
| Ga0180065_10940042 | 3300014878 | Soil | RYYEQGKQMLVAAVASEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0157376_122617911 | 3300014969 | Miscanthus Rhizosphere | RRYYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0157376_126074871 | 3300014969 | Miscanthus Rhizosphere | DEERRYYEQGKGMLAAAALTEESQARGRRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0137409_101494171 | 3300015245 | Vadose Zone Soil | QVALNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKKR* |
| Ga0132256_1005941431 | 3300015372 | Arabidopsis Rhizosphere | RRYYEQGKQMLVASVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR* |
| Ga0132255_1003665551 | 3300015374 | Arabidopsis Rhizosphere | IMGQERRYYESGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR* |
| Ga0182036_113241651 | 3300016270 | Soil | LLGVELLGEERRYYEEGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0184604_103642231 | 3300018000 | Groundwater Sediment | VAAVTTEESQARARRAAYRTLELAGETAEPLQLRKALGRRR |
| Ga0187765_110992462 | 3300018060 | Tropical Peatland | ALVASASNEESQARARRSAYRTLELAGEMAEPLQIRKALPKRR |
| Ga0193703_10733082 | 3300019876 | Soil | AVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| Ga0193697_10318381 | 3300020005 | Soil | TEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| Ga0210396_109369051 | 3300021180 | Soil | STDFLDEERRYYDEGRRMLIASTATEESQARARRAAYRTLELAGETVEPLQLRKTLGKRR |
| Ga0210385_110693382 | 3300021402 | Soil | GLLASVALNEESQARGRRSAYRTLELATEATEPLQLRKLLPKRR |
| Ga0210389_107086181 | 3300021404 | Soil | RLLVGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0210392_103245952 | 3300021475 | Soil | KGLLASVALNEESQARGRRSAYRTLELATEATEPLQLRKLLPKKR |
| Ga0247673_10194291 | 3300024224 | Soil | YEQGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0247679_10224251 | 3300024251 | Soil | MLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0207707_102190612 | 3300025912 | Corn Rhizosphere | RYYETGKAMLVVAVASEESQARARRSAYRTLELAGETVEPLQLRKALGKRR |
| Ga0207707_106693932 | 3300025912 | Corn Rhizosphere | DEGRLMLIASATAEESQARARRAAYRTLELAGEIVEPLALRRSLGRRR |
| Ga0207650_112834141 | 3300025925 | Switchgrass Rhizosphere | LGVDMLSEERRYYELGKRMLTAVATTEESQARARRAAYRTLDLAGETAEPLQLRKALGKR |
| Ga0207701_106669891 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| Ga0207644_108450641 | 3300025931 | Switchgrass Rhizosphere | LVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0207709_111787552 | 3300025935 | Miscanthus Rhizosphere | QERRYYEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0207661_107132321 | 3300025944 | Corn Rhizosphere | YEQGKQMLVAAVPTEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0207661_110316012 | 3300025944 | Corn Rhizosphere | EEGKRILSATAATEESQARARRAAYRTLELAGDMNEPIQLRKILLKKR |
| Ga0207702_101494652 | 3300026078 | Corn Rhizosphere | TDMVAEERRYYDEGRVLLTGAATTEESQARGRRAAYRTLELAGETVEPLALRRSLGRRR |
| Ga0207702_111342042 | 3300026078 | Corn Rhizosphere | LRLLVGATVTEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0209849_10574421 | 3300026215 | Soil | SLRYYEEGRLMLAAVATNEESQARGRRSAYRTLELATEMVEPLQLRKLLRKRR |
| Ga0209167_101113062 | 3300027867 | Surface Soil | EGLRLLVGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0209275_100997192 | 3300027884 | Soil | GATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0247675_10469861 | 3300028072 | Soil | AATEESQARARRAAYRTLELAGDMNEPIQLRKILLKKR |
| Ga0247822_110904401 | 3300028592 | Soil | QMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGRRR |
| Ga0265316_100170457 | 3300031344 | Rhizosphere | EEGKRLLTAVALNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKKR |
| Ga0307506_103078191 | 3300031366 | Soil | QERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| Ga0318538_100192053 | 3300031546 | Soil | IVEEERRYYEEGMRLLIGATATEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0318515_103741511 | 3300031572 | Soil | YYEEGMRLLIGATATEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0318542_103382962 | 3300031668 | Soil | YEEGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0318574_107891481 | 3300031680 | Soil | TEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0318502_106522811 | 3300031747 | Soil | QERRYYEEGKRLLTAAATNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKKR |
| Ga0318554_107965042 | 3300031765 | Soil | LSEERRYYDEGKRMLIAAAGVEESQARARRAAYRTLELAMETAEPLQLRKALGKRR |
| Ga0318552_100835861 | 3300031782 | Soil | GTEESQARARRAAFRTLELAGETVEPLQLRKAFGRRRSLV |
| Ga0318548_106791701 | 3300031793 | Soil | VEEERRYYEEGMRLLIGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0318523_102110722 | 3300031798 | Soil | GKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0318568_104987051 | 3300031819 | Soil | LGVEILGEERRYYEDGKQLLTAAAGTEESQARARRAAFRTLELAGETVEPLQLRKAFGRRRSLV |
| Ga0310904_105895081 | 3300031854 | Soil | RLLGVEIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETVEPLQLRKALGKRR |
| Ga0306925_108083011 | 3300031890 | Soil | AGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0310900_109670511 | 3300031908 | Soil | IMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| Ga0308175_1019517652 | 3300031938 | Soil | LRLLVGATATEESQARARRAAYRTLELAGETVEPLALRKTLGKRR |
| Ga0310884_106625311 | 3300031944 | Soil | RLLGVEIMTQERRYYEQGKQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| Ga0308176_124024821 | 3300031996 | Soil | RLLGTDMVADERRYYDEGRVLLTGAATTEESQARGRRSAYRTLELAGETVEPLALRRSLGRRR |
| Ga0318507_103996781 | 3300032025 | Soil | EERRYYEEGKQMLTAAAGTEESQARARRAAFRTLELANETVEPLQLRKAFGRRRSLV |
| Ga0318556_106480872 | 3300032043 | Soil | LLTQERRYYEEGKRLLMAAAQNEESQARGRRSAYRTLELADDMVEPLQLRKLLPKKR |
| Ga0318506_105394521 | 3300032052 | Soil | LLTAVAVNEESQARGRRSAYRTLELATEMVEPLQLRKLLPKRR |
| Ga0318524_102968102 | 3300032067 | Soil | TLLTQERRYYEEGKRLLMAAAQNEESQARGRRSAYRTLELADDMVEPLQLRKLLPKRR |
| Ga0310896_108015061 | 3300032211 | Soil | KQMLVAAVATEESQARARRAAYRTLELAGETAEPLQLRKALGKRR |
| ⦗Top⦘ |