NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099344

Metagenome / Metatranscriptome Family F099344

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099344
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 103 residues
Representative Sequence KYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIKNLLKDKSHHASESKVVHYPDRVGTNYVKSDALSCYKVHPSGSKPSF
Number of Associated Samples 91
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 16.83 %
% of genes near scaffold ends (potentially truncated) 42.72 %
% of genes from short scaffolds (< 2000 bps) 98.06 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (74.757 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.155 % of family members)
Environment Ontology (ENVO) Unclassified
(51.456 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.845 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.15%    β-sheet: 0.00%    Coil/Unstructured: 59.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.70 %
UnclassifiedrootN/A23.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000949|BBAY94_10194388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300003909|JGI26087J52781_1025014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea638Open in IMG/M
3300004095|Ga0007829_10089395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR43617Open in IMG/M
3300004767|Ga0007750_1137796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300004769|Ga0007748_11373527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300004792|Ga0007761_11054513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300006129|Ga0007834_1094951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Asinibacterium → unclassified Asinibacterium → Asinibacterium sp. OR43637Open in IMG/M
3300006399|Ga0075495_1452116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea677Open in IMG/M
3300006641|Ga0075471_10602108Not Available539Open in IMG/M
3300006875|Ga0075473_10305659Not Available643Open in IMG/M
3300007231|Ga0075469_10182148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300008936|Ga0103739_1047097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea603Open in IMG/M
3300008952|Ga0115651_1352363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea860Open in IMG/M
3300009003|Ga0102813_1130374Not Available791Open in IMG/M
3300009187|Ga0114972_10531473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea663Open in IMG/M
3300009432|Ga0115005_10975903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300009432|Ga0115005_11311543Not Available590Open in IMG/M
3300009434|Ga0115562_1312846Not Available536Open in IMG/M
3300009436|Ga0115008_10367530Not Available1020Open in IMG/M
3300009436|Ga0115008_10808897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300009436|Ga0115008_11093664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300009441|Ga0115007_10443964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea852Open in IMG/M
3300009442|Ga0115563_1347577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea534Open in IMG/M
3300009470|Ga0126447_1094478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea730Open in IMG/M
3300009472|Ga0115554_1420984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300009497|Ga0115569_10170333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1027Open in IMG/M
3300009592|Ga0115101_1092191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea653Open in IMG/M
3300009599|Ga0115103_1366644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300009599|Ga0115103_1374180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea758Open in IMG/M
3300009599|Ga0115103_1709392Not Available761Open in IMG/M
3300009608|Ga0115100_10238233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300009677|Ga0115104_10560795Not Available544Open in IMG/M
3300010368|Ga0129324_10418583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300012416|Ga0138259_1143206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300012953|Ga0163179_11758664Not Available565Open in IMG/M
3300013295|Ga0170791_10161898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300016723|Ga0182085_1344769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea590Open in IMG/M
3300017709|Ga0181387_1106510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300017769|Ga0187221_1150304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300017770|Ga0187217_1202718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300017782|Ga0181380_1194676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300017818|Ga0181565_10792827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300017950|Ga0181607_10668491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300017962|Ga0181581_10910805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300017967|Ga0181590_11078121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300018415|Ga0181559_10767360Not Available514Open in IMG/M
3300018876|Ga0181564_10669178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300018980|Ga0192961_10150724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea708Open in IMG/M
3300018980|Ga0192961_10224359Not Available558Open in IMG/M
3300018982|Ga0192947_10294141Not Available510Open in IMG/M
3300018989|Ga0193030_10259137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300019010|Ga0193044_10196822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300019031|Ga0193516_10205837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300019031|Ga0193516_10228093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300019032|Ga0192869_10282953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea722Open in IMG/M
3300019033|Ga0193037_10186382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea699Open in IMG/M
3300019050|Ga0192966_10199582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300019095|Ga0188866_1020771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea690Open in IMG/M
3300019097|Ga0193153_1034586Not Available516Open in IMG/M
3300019149|Ga0188870_10115218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300020205|Ga0211731_11604377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea914Open in IMG/M
3300021085|Ga0206677_10339876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300021169|Ga0206687_1093061Not Available755Open in IMG/M
3300021359|Ga0206689_10782370Not Available650Open in IMG/M
3300021359|Ga0206689_10808037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea760Open in IMG/M
3300021869|Ga0063107_103008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea737Open in IMG/M
3300021899|Ga0063144_1064909Not Available658Open in IMG/M
3300021925|Ga0063096_1009881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea652Open in IMG/M
3300021925|Ga0063096_1032523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300021927|Ga0063103_1156873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300023694|Ga0228683_1041661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300023696|Ga0228687_1023807Not Available708Open in IMG/M
3300025138|Ga0209634_1291347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300025379|Ga0208738_1056585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea554Open in IMG/M
3300025636|Ga0209136_1062980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1190Open in IMG/M
3300026468|Ga0247603_1122957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300027720|Ga0209617_10169092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea853Open in IMG/M
3300027760|Ga0209598_10200787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea843Open in IMG/M
3300027810|Ga0209302_10221975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea898Open in IMG/M
3300027833|Ga0209092_10287593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea893Open in IMG/M
3300027833|Ga0209092_10607122Not Available546Open in IMG/M
3300027849|Ga0209712_10638233Not Available590Open in IMG/M
3300028137|Ga0256412_1184847Not Available770Open in IMG/M
3300028137|Ga0256412_1327547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300028290|Ga0247572_1158155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300028335|Ga0247566_1057893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea647Open in IMG/M
3300030670|Ga0307401_10508905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300030702|Ga0307399_10276569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea794Open in IMG/M
3300030709|Ga0307400_10783773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea589Open in IMG/M
3300030729|Ga0308131_1126073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300030788|Ga0073964_11668988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300031523|Ga0307492_10323053Not Available579Open in IMG/M
3300031579|Ga0308134_1149676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300031729|Ga0307391_10649993Not Available599Open in IMG/M
3300031734|Ga0307397_10431537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300031734|Ga0307397_10509573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300031735|Ga0307394_10473695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300031737|Ga0307387_11080078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300031739|Ga0307383_10577459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300031742|Ga0307395_10473582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300034022|Ga0335005_0312656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea929Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.16%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.50%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.80%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.88%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.91%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.94%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.94%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.97%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.97%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.97%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.97%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.97%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.97%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.97%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.97%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.97%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006129Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025379Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030729Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY94_1019438813300000949Macroalgal SurfaceMSDFDLLLEGVLNERFIDESTAYYNDPVVSSEVEDMEKGLNGEFADEDIRNLLKDKGSHGAGEKTFRYPGRVASNYKASDDLSIYKTYPVDSKPSF*
JGI26087J52781_102501413300003909MarineMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPTVTKEIEDMELGLNGEFAEDDIRNLLKDKSSHDSASKVVHYPDRVGTNYVKSDALSCYKVHPSGSK
Ga0007829_1008939513300004095FreshwaterMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKDDHGSETKVLRYPGRVGTRYDATDDLSIYKTHPSGSKPSF*
Ga0007750_113779623300004767Freshwater LakeMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKNDHGSETKIVRYPARAGTRYDDTDDLSIYKTHPSGSKPAF*
Ga0007748_1137352713300004769Freshwater LakeMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKNDHGSETKIVRYPARAGTRYDDTDDLSIYKTHPS
Ga0007761_1105451313300004792Freshwater LakeMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKNDHGSETKIVRYPARAGTRYDDTDDLSIYKTHPSGSKP
Ga0007834_109495113300006129FreshwaterMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKDDHGSETKVLRYPGRVGTRYDATDDLSIYKTHPSGSKPSF*NN*
Ga0075495_145211613300006399AqueousMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVTKEIEDMELGFQDEFAEADIKNLLKDKSHHADAGKVIHYPDRVGSNYPKTDDLSCYKVHPKGVKP*
Ga0075471_1060210813300006641AqueousTRFMSDFDLLLDSVLNQRFLDESTLYYDDPVVSKEIEDMEQGLNGEFSNDDIRNLLKDRDEGHHDKHKSLRYPARCGYNYQASDDLSIYKVHPVGTKPV*
Ga0075473_1030565923300006875AqueousVFFRLQSIFQKNKYGYNTRFMSDFDLLLDSVLNQRFLDESTLYYDDPVVSKEIEDMEQGLNGEFSNDDIRNLLKDRDEGHHDKHKSLRYPARCGYNY
Ga0075469_1018214813300007231AqueousKEAEVYFRLNSIFAKNKYGYNTRFMSDFDLLLEGILNERFIDESTLYYDDPVVAKEIEDMEAGLSGDFAEEDIKNLLKDKSSHGSHHKSVRFPGRVGSNYGKTDDLSCYKVHPSGSKPAF
Ga0102818_111393523300007552EstuarineLLLDALLNERFLDEAALYNEDPNIMKEIDDMEKGLNGEFAESDIKNLLKDTGAHGSGMHKTLQYPGRVGTNYQKSDDLSCYKVHPRGTKPSF*
Ga0103739_104709713300008936Ice Edge, Mcmurdo Sound, AntarcticaMIKFAFGFTKVPEENKNSTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKSKEIEDMEQGLNGEFSEDDIKDLIKDKSDHGGADLVMRYPGRVGTNYQPSDDLSI
Ga0115651_135236313300008952MarineMSDFDLLLDSMLNERFIDESTLYYDNPVKSKEIEDMELGLNGEFAEDDIKDLLKDKSDHGAGFKSLKYPGRVGSNYGGKYNDMSCYKVHPSGSKPAF*
Ga0102813_113037413300009003EstuarineMSDFDLLLEGMLNERFIDESTLYQEDPVVSKEIEDMEGGLSGEFSEADIKNLTKDKSSHAEASKVLRYPGRVGTNYVRSDDLSCYKVHPVEEKRPFF*
Ga0114972_1053147313300009187Freshwater LakeMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKNDHGSETKIVRYPARAGTRYDDTD
Ga0115005_1097590323300009432MarineMSDFDLLLEGALNERFIDESTLYYDDPVVSTEIEDMEAGLNGEFAEDDIKNLLKDKSGHGSEHKSLRFPDRVGNGYAKSDNLSCYKVHPSGSKPAF*
Ga0115005_1131154323300009432MarineYGYNTRFMSDFDLLLEGLLNERFIDESTLYQEDPVVAKEIEDMEMGLSGEFSEADIKNLTKDKSSHAEATKVLRYPGRVGTNYVRSDDLSCYKVHPVEEKKPFF*
Ga0115562_131284613300009434Pelagic MarineERFIDESTLYQEDPVVAKEIEDMEMGLSGEFSEADIKNLTKDKSSHAEATLVMRYPGRVGTNYGRSDDLSCYKVHPIEEKRPFM*
Ga0115008_1036753013300009436MarineMRLQSIFAKNKYGYNTRFMSDFDLLLEGLLNERFIDESTLYQEDPVVSKEIEDMESGLSGEFSEADIKNLTKDKSSHAEAAKVVRYPGRVGTNYVRSDDLSCYKVHPVEEKRPFY*
Ga0115008_1080889713300009436MarineMSDFDLLLESALNEKFIDESTLYYDNYVKSKEIEDMEAGLNGEFAEDDIKDLIKDRSEHGSPALVMQYPGRVGSNY*
Ga0115008_1109366423300009436MarineSKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPTVAKEIEDMEAGLNGEFAEGDIKNLLKDKSHHGSQHKSLRYPGRVGYNYGRSDDLSIYKVHPTGSGPAF*
Ga0115007_1044396423300009441MarineMRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFIDESTLYYDDPVVSTEIEDMEAGLNGEFAEDDIKNLLKDKSGHGSEHKSLRFPDRVGNNYQKSDDLSCYKVHPSGTKPSF*
Ga0115563_134757713300009442Pelagic MarineEVYFRLNSIFMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIRNLLKDKSHHASESKVVHYPDRVGTNYPKSDNLSCYKVHPTGSKPSF*
Ga0126447_109447823300009470Meromictic PondMSDFDLLLEGVLNERFIDESTTYYDDPVVAKEIEDMEQGLNGEFADDDIKNLLKDKSHHASRGKTVRYPGRVGSNYQKSDDLSCYKVHPSGSKPAF*
Ga0115554_142098413300009472Pelagic MarineKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIRNLLKDKSHHASESKVVHYPDRVGTNYPKSDNLSCYKVHPTGSKPSF*
Ga0115569_1017033323300009497Pelagic MarineMSDFDLLLESALNERFVDESTAYYDNPVKAKEVEDMEQGLNGEFSEDDIKDLIKDKSEHGTAAIIMHYPGRVGSNYRVSDDLSIYKTHPSGSKPAF*
Ga0115101_109219123300009592MarineMSDFDLLLEGVLNERFIDESTLYYDNPVVAKEIEDMELGLNGEFAEDDIKNLLKDKHDHAAGKKVVKYPGRVGSNYDKTDDLSCYKTFPSGSKPSF*
Ga0115103_136664413300009599MarineEVYMRLNSIFAKNKYGYNTRFMSDFDLLLEGMLNERFVDESTLYYDDPVVSKEIEDMELGHAGEFAEDDVKNLLKDKSSHGSMHKSIRYPGRVGSNYQKSDDLSCYKVHPSGSKPNF*
Ga0115103_137418023300009599MarineMSDFDLLLEGVLNERFIDESTLYYDDEAVATEIEDMETGLNGEFAESDIKNLLKDKSDHGADNRVLHYPGRVGTNYAKSDDLSCYKLHPSGSKPAF*
Ga0115103_170939223300009599MarineMSDFDLLLEGMLNERFIDESTLYQEDPVVSKEIEDMEGGLSGEFSEADIKNLTKDKTSHAEASKVLRYPGRVGTNYVRSDDLSCYKVHTVEEKKPFY*
Ga0115100_1023823313300009608MarineLTAVSSIKFAFGFTKQKEEDKTSKEIYFRLNSLFAKNKYGYNTRFMSDFDLLLESALNERFVDESTMYYDNPVKAKEIEDMEQGLNGEFSEDDIKDLIKDKSEHGTPALVMRYPGRVGSNY*
Ga0115104_1056079523300009677MarineMSDFDLLLEGLLNERFIDESTLYQEDPVVSKEIEDMESGLSGEFSEADIKNLTKDKSSHAEASKVVRYPGRVGTNYVRSDDLSCYKVHPVEEKKPFY*
Ga0129324_1041858313300010368Freshwater To Marine Saline GradientKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIKNLLKDKSHHASESKVVHYPDRVGTNYVKSDALSCYKVHPSGSKPSF*
Ga0138259_114320613300012416Polar MarineMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVTKEIEDMELGFQDEFAESDIKNLLKDKSHHADAGKVVHYPDRVGSNYPKTDDLSCYKVHPKGTKP
Ga0163179_1175866423300012953SeawaterLNERFVDESTLYYDDDVVSTEIEDMEAGLNGEFSEDDVRNLLKDKSGHGEAHKSLRFPDRVGNGYGKSDDLSCYKVHPSGSKPAF*
Ga0170791_1016189813300013295FreshwaterMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFSEDDIRHLLKDKSDHGAETKILRYPGRAGTNYEATD
Ga0182085_134476923300016723Salt MarshMSDFDLLLEGVLNERFIDESTTYYDDPVVAKEIEDMELGLNGEFAEDDIKNLLKDKSAHASRGKTVRFPGRVGSNYGKSDDLSCYKVHPTGS
Ga0181387_110651013300017709SeawaterLNSIFMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDNEAVTPEIEDMEQGLNGEFSEEDVKGLLKDKHDHGAEFKSLRYPGRVGTNYAKTDDLSCYKVHPSGSKPAY
Ga0187221_115030423300017769SeawaterVSFLKFAFGFTSKPEENKTQTEIYFRLKSIFAQNKYGYNTRFMSDFDLLLESALNERFVDESTAYYDNPIKSKEIEDMEQGLNGEFAEDDIKDLIKDTSAHGSRALTMHYPGRVASNYQPSDDLSIYKTHPSGSKPSY
Ga0187217_120271813300017770SeawaterLTAVSFLKFWFSFSAVPEENKQQTEIYFRLKSIFSQNKYGYNTRFMSDFDLLLESALNERFVDESTAYYDNPIKAKEIEDMEQGLNGEFAEDDLKDLVKDKSEHGSRQLVMRYPGRVGSNYQASDDLSIYKTHPSGSGPKF
Ga0181380_119467623300017782SeawaterVSFLKFSFGFSQQPEENKQGTEIYFRLQSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKSKEIEDMEQGLNGEFSEDDIKDLIKDKSDHGAADLVMRYPGRVGTNYQ
Ga0181565_1079282713300017818Salt MarshMSDFDLLLEGVLNERFIDESTTYYDDPVVAKEIEDMELGLNGEFAEDDIKNLLKDKSAHASRGKTVRFPGRVGSNYGKSDDLSCYKVHPTGSKPSF
Ga0181607_1066849113300017950Salt MarshNSIFMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIRNLLKDKSHHASESKVVHYPDRVGTNYPKSDNLSCYKVHPSGSKPSF
Ga0181581_1091080513300017962Salt MarshGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIKNLLKDKSHHASAGKIVHYPDRVGDNYAKSDNLSCYKVHPSGSKPAF
Ga0181590_1107812113300017967Salt MarshYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIKNLLKDKSHHASAGKIVHYPDRVGDNYAKSDNLSCYKVHPSGSKPAF
Ga0181559_1076736013300018415Salt MarshGVLNERFIDESTLYYDDPVVSKEIEDMELGYAGEFAEDDIKNLLKDKSSHGALHKSVRYPGRVGSNYGRSDDLSCYKVHPSGSKPAF
Ga0181564_1066917813300018876Salt MarshFMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIRNLLKDKSHHASESKVVHYPDRVGTNYPKSDNLSCYKVHPSGSKPSF
Ga0192961_1015072413300018980MarineMSDFDLLLEGVLNERFIDESTLYYDDEVVATEIEDMEAGLNGEFADDDIKNLLKDKSHHGDAAKVVHFPDRVGTNYPKSDDLSCYKVHPSGTKPNF
Ga0192961_1022435913300018980MarineMSDFDLLLEGMLNERFIDESTLYQEDPVVSKEIEDMEGGLSGEFSEADIKNLTKDKSSHAEASKVLRYPGRVGTNYVRSDDLSCYKVHTVEEKKPFY
Ga0192947_1029414113300018982MarineQSIFNKNKYGYNTRFMSDFDLLLEGLLNERFIDESTLYQEDPSVAKEIEDMEAGLSGEFSEADIKNLTKDKSSHGDETKVVRYPGRVGTNYVRSDDLSCYKVHPVEEKKPFF
Ga0193030_1025913713300018989MarineKMCKNYSSSRLMAFIWGLTFLSGVKFMLGFSSKAEKNTKGDEIYFRLNSVFAKNKYGYNTRFMSNFDLLLEGAINERFIDEATLYYENPVKTKEIEDMEQGLNGELAEDDIKDLIKDK
Ga0193044_1019682213300019010MarineMSDFDLFLDSLLNERFIDESTAYYADPIVSSEVEDMEKGLSGEFSEDDIRNLVKDKNEHGAPNKFFRYPGRVATNYKASDDLSIYKTHPVDSKPKY
Ga0193516_1020583713300019031MarineMSDFDLLLESTLNERFLDESVAYYDDEVVAEEIADMEMGLNNEFSEDDVKNLLKDKGHHASGSPMIVHYPDRVGTNYPKSDDLSCYKVHPKEAGPSS
Ga0193516_1022809323300019031MarineMSDFDLLLESTLNERFLDESVAYYDDEVVAEEINDMELGLNNEFSEDDVKNLLKDKGHHASGSPMTIHYPDRVGSNYPKSDDLSCYKVHPSSAGPAA
Ga0192869_1028295313300019032MarineMYFRLNSIFSKNKYGYNTRFMSDFDLLLESALNERFVDESTMYYDNPVKAKEIEDMETGLNGELSEDDIKDLIKDKSEHGTAALVMRYPGRVGSNYKVSDDLSVYKTHPSGSKPAF
Ga0193037_1018638213300019033MarineMSDFDLLLEGALNERFIDESTLYYDDEVVSKEIEDMEQGLNGEFAEDDIKNLLKDKSAHGSGSLTMHYPARVGTNYQGSDDLSCYKTHPSGSKPAF
Ga0192966_1019958213300019050MarineMVKFAMSFTAIPEENKNGTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKGKEIEDMEQGLNGEFSEDDIKDMIKDKSDHGGADLVMRYPGRVGTNYQPSDDLSIYKTHPSGSKPMY
Ga0188866_102077113300019095Freshwater LakeMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVTKEIEDMELGFQDEFAEADIKNLLKDKSHHADAGKVIHYPDRVGSNYPKTDDLSCYKVHPKGVKP
Ga0193153_103458613300019097MarineFTKNKYGYNTRFMSDFDLLLEGLLNERFIDESTLYQEDPVVAKEIEDMEAGLNGEFSEADIKNLTKDKSSHADPAKVVRYPGRVGTNYVRSDDLSCYKVHPVEEKRPFYXGRNSEECYPHTN
Ga0188870_1011521823300019149Freshwater LakeMSDFDLLLEGVLNERFIDESTLYYDDEVVATEIEDMEAGLNGEFAEDDIKNLLKDKSHHGDAAKVVHFPDRVGSNYPKSDDLSCYKVHPSGSKPNFXEYCVCIPVPC
Ga0211731_1160437723300020205FreshwaterMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFSEDDIRHLLKDKSDHGAETKILRYPGRAGTNYEATDDLSIYKTHPSGSKPSF
Ga0206677_1033987613300021085SeawaterMSDFDLLLEGVLNERFIDESTLYYDDEAVATEIEDMETGLNGEFAESDIKNLLKDKSDHGADNRVLHYPGRVGTNYAKSDDLSCYKLHPSGSKPAF
Ga0206687_109306123300021169SeawaterMSDFDLLLEGLLNERFIDESTLYQEDPVVSKEIEDMESGLSGEFSEADIKNLTKDKSSHAEAAKVVRYPGRVGTNYVRSDDLSCYKVHPVEEKKPFY
Ga0206689_1078237013300021359SeawaterMSDFDLLLEGLLNERFIDESTLYQEDLISSSEIEDMESGYAGEFSDADIKNLTKDKNAHGAETKIIRYPGRVGTNYAKSDDLSCYKVHPVGTKPSF
Ga0206689_1080803723300021359SeawaterMSDFDLLLEGVLNERFIDESSLYYDDEAVATEIEDMATGLNGEFAESDIKNLLKDKSDHGADNRVLHYPGRVGTSYAKSDDLSCYKLHPSGSKPAF
Ga0063107_10300823300021869MarineMRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFIDESTLYYDDPVVSTEIEDMEAGLNGEFAEDDIKNLLKDKSGHGSEHKSLRFPDRVGNNYQKSDDLSCYKVHPSGTKPSFXENLLINQ
Ga0063144_106490923300021899MarineMSDFDLLLEGMLNERFIDESTLYQEDPVVAKEIEDMEGGLSGEFSEADIKNLTKDKSSHAEASKVLRYPGRVGTNYVRSDDLSCYKVHTVEEKKPFY
Ga0063096_100988123300021925MarineMRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFIDESTLYYDDPVVSTEIEDMEAGLNGEFAEDDIKNLLKDKSGHGSEHKSLRFPDRVGNNYQKSDDLSCYKVHPSGTKPSF
Ga0063096_103252323300021925MarineMRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFVDESTLYYDDEVVSKEIEDMEQGLNGEFAEDDIKNLLKDKSAHGDGHKSLRFPDRVGNNYVKSDDLSCYKVHPSGSKPAFXEGKQ
Ga0063103_115687313300021927MarineMSDFDLLLEGVLNERFIDESTLYYDDEVVASEIEDMEAGLNGEFADDDIKNLLKDKSHHGDPSKVVHFPDRVGTNYPKSDDMSCYKVHPSGSKPSF
Ga0228683_104166113300023694SeawaterMSDFDLLLEGVLNERFIDESTLYYDDEVVATEIEDMEAGLNGEFAEDDIKNLLKDKSHHADAAKVVHFPDRVGSNYPKSDDLSCYKVHPSGSRPNF
Ga0228687_102380723300023696SeawaterMSDFDLLLEGLLNERFIDESTLYQEDPVVSKEIEDMESGLSGEFSEADIKNLTKDKSSHAEASKVVRYPGRVGTNYVRSDDLSCYKVHPVEEKKPFY
Ga0209634_129134713300025138MarineMQTEIYFRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFVDESTLYYDDEVVSKEIEDMEAGLNGEFAEDDIRNLLKDKSSHGEGAKVLRFPDRVGTGYGKSDDLSCYKVHPSGSKPAF
Ga0208738_105658513300025379FreshwaterMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKDDHGSETKVLRYPGRVGTRYDATDDLSIYKTHPSGSKPSFXNN
Ga0209136_106298023300025636MarineMKNKYGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVAKEIEDMELGLNGEFAEDDIRNLLKDKSHHASESKVVHYPDRVGTNYPKSDNLSCYKVHPSGSKPSF
Ga0247603_112295723300026468SeawaterMSDFDLLLEGVLNERFIDESTLYYDDEVVATEIEDMEAGLNGEFAEDDIKNLLKDKSHHADAAKVVHFPDRVGSNYPKSD
Ga0209617_1016909213300027720Freshwater And SedimentMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKNDHGSETKIVRYPARAGTRYDDTDDLSIYKTHPSGSKPAF
Ga0209598_1020078723300027760Freshwater LakeMSDFDLLLEGVLNERFIDESTLYYDNPIVAKEIEDMELGLNGEFAEDDIRNLLKDKNDHGSETKIVRYPARAGTRYDDTDDLSIYKTHPSGSKPAFXNY
Ga0209302_1022197523300027810MarineMRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFIDESTLYYDDPVVSTEIEDMEAGLNGEFAEDDIKNLLKDKSGHGSEHKSLRFPDRVGNNYQKSDDLSCYKVHPSGTKPSFXENLLINQGKYYLKDKYAFININAHTGVLGFW
Ga0209092_1028759313300027833MarineMSDFDLLLESALNEKFIDESTLYYDNYVKSKEIEDMEAGLNGEFAEDDIKDLIKDRSEHGSPALVMQYPGRVGSNY
Ga0209092_1060712223300027833MarineLLEGVLNERFIDESTLYYDDPTVAKEIEDMEAGLNGEFAEGDIKNLLKDKSHHGSQHKSLRYPGRVGYNYGRSDDLSIYKVHPTGSGPAF
Ga0209712_1063823313300027849MarineYGYNTRFMSDFDLLLEGLLNERFIDESTLYQEDPVVAKEIEDMEMGLSGEFSEADIKNLTKDKSSHAEATKVLRYPGRVGTNYVRSDDLSCYKVHPVEEKKPFF
Ga0256412_118484723300028137SeawaterMSDFDLLLEGLLNERFIDESTLYQEDPVVAKEIEDMEAGLNGEFSEADIKNLTKDKSSHGEPSKVVRYPGRVGTNYVRSDDLSCYKVHPVEDKKPFY
Ga0256412_132754723300028137SeawaterLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFVDESTLYYDDEVVAEEIEDMEKGLNGEFSEDDIRNLLKDKSHHGETEKALRFPDRVGSGYGRTDNLSCYKVHPSGSKP
Ga0247572_115815523300028290SeawaterLTAVSAIKFAFGFTKQKEEDKTSKEIYFRLNSLFAKNKYGYNTRFMSDFDLLLESALNERFVDESTMYYDNPIKAKEIEDMEQGLNGEFSEDDIKDLIKDKSEHGTPALVMRYPGRVGSN
Ga0247566_105789323300028335SeawaterMSDFDLLLEGVLNERFIDESTLYYDDEVVATEIEDMEAGLNGEFAEDDIKNLLKDKSHHADAAKVVHFPDRVGSNYPKSDDLSCYKVHPSGSKPNF
Ga0307401_1050890523300030670MarineMSDFDLLLEGALNERFVDESTLYYDDEIVSTEIEDMEQGLNGEFAEDDIKNLLKDTSKHGSSSLTMHYPGRVGTNYAGSD
Ga0307399_1027656913300030702MarineMSDFDLLLEGVLNERFIDESTLYYDDETVATEIEDMETGLNGEFSDADVKNLLKDKSPEHGDASRVLHYPGRVGTNYAKSDDLSCYKLHPSGSKPAF
Ga0307400_1078377313300030709MarineMIKFAFGFTKVPEENKNSTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKGKEIEDMEQGLNGEFSEDDIKDMIKDKSDHGGADLVMRYPGRVGTNYQPSDDLSIYKTHP
Ga0308131_112607313300030729MarineMKNKFGYNTRFMSDFDLLLEGVLNERFIDESTLYYDDPSVTKEIEDMELGFQDEFAESDIKNLLKDKSTHASAGKVVHYPDRVVSNYPKTDDLSCYKVHPKGQKP
Ga0073964_1166898813300030788MarineLNSLFAKNKYGYNTRFFADFDLFLESVLNERFVDESTEYYKDPIVAGEVDDMEKGLNGEFSEDDIRNLLKDKHDHAEGNKFFRYPARVGTNYTASDDLSIYKTHPVGSGPKS
Ga0307492_1032305313300031523Sea-Ice BrineMSDFDLLLEGLLNERFIDESTLYQEDPSVAKEIEDMEAGLSGEFSEADIKNLTKDKSSHAEPTKVLRYPGRVGTNYVRSDDLSCYKVHPVQEKKPFF
Ga0307489_1130182813300031569Sackhole BrineNKYGYNTRFMSDFDLLLDAMLNERFLDEAAAYNEDPQVMKEIEDMELGLNGEFAESDVKNLLKDHGEHPEIAKSLRNPGLVGSNYGKTDDLSCYKVFPSGSKPAF
Ga0308134_114967613300031579MarineMRLNSIFAKNKYGYTTRFMSDFDLLLEGALNERFVDESTLYYDDEVVSKEIEDMEQGLNGEFAEDDIKNLLKDKSAHGDGHKSLRFPDRVGNNYV
Ga0307391_1064999323300031729MarineMSDFDLLLEGLLNERFIDESTLYQEDPVVSKEIEDMESGLSGEFSEADIKNLTKDKSSHAEAAKVVRYPGRVGTNYVRSDDLSCYKVHPVEEK
Ga0307397_1043153713300031734MarineMSDFDLLLEGALNERFVDESTLYYDDEIVSTEIEDMEQGLNGEFAEDDIKNLLKDTSKHGSSSLTMHYPGRVGTNYAGSDDLSCYKTHPAGSKPAF
Ga0307397_1050957313300031734MarineMIKFAFGFTKVPEENKNSTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKSKEIEDMEQGLNGEFSEDDIKDLIKDKSDHGGADLVMRYPGRVGTNYQPS
Ga0307394_1047369513300031735MarineMVKFAMSFTAIPEENKNGTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKGKEIEDMEQGLNGEFSEDDIKDMIKDKSDHG
Ga0307387_1108007813300031737MarineMVKFAMSFTAIPEENKNGTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKGKEIEDMEQGLNGEFSEDDIKDMIKDKSDHGGADL
Ga0307383_1057745923300031739MarineMSDFDLLLEGVLNERFIDESTLYYDDPMVMPEIGDMEKGLNSDFAEADVKNLLKDKGSHAPEMHKSLRYPGRVGSNY
Ga0307395_1047358213300031742MarineMVKFAMSFTAIPEENKNGTEIYFRLNSIFAKNKYGYATRFMSDFDLLLESALNERFVDESTQYYDNVIKGKEIEDMEQGLNGEFSEDDIKDMIKDKSDHGGADLVMRYPGRVGTN
Ga0335005_0312656_433_7443300034022FreshwaterMGYNTRFMSDFDLFLESVLNERFIDESTLYYDNPNKAKEIEDIESGLNSEFAEDDIKEILKDSHEHGDEFKCLRFPDRVGNNYPKSDDLSIYKVHPSGSKPAF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.