| Basic Information | |
|---|---|
| Family ID | F099312 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLFADFRFAEM |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 99.02 % |
| % of genes near scaffold ends (potentially truncated) | 97.09 % |
| % of genes from short scaffolds (< 2000 bps) | 86.41 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (62.136 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (19.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (49.515 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 12.62 |
| PF02467 | Whib | 0.97 |
| PF02675 | AdoMet_dc | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.58 % |
| Unclassified | root | N/A | 19.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10155646 | Not Available | 561 | Open in IMG/M |
| 3300005517|Ga0070374_10210107 | Not Available | 1000 | Open in IMG/M |
| 3300005662|Ga0078894_10953289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300005662|Ga0078894_11089764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300006484|Ga0070744_10002231 | Not Available | 5870 | Open in IMG/M |
| 3300006484|Ga0070744_10070568 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300006484|Ga0070744_10150173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300007551|Ga0102881_1151975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300007557|Ga0102821_1100244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300007600|Ga0102920_1222378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300007634|Ga0102901_1222300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300007637|Ga0102906_1121504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300007651|Ga0102900_1062977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300007665|Ga0102908_1050838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300007665|Ga0102908_1101623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300008052|Ga0102893_1098353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
| 3300008052|Ga0102893_1166279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300008107|Ga0114340_1139459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300008107|Ga0114340_1225087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300008108|Ga0114341_10032623 | Not Available | 3546 | Open in IMG/M |
| 3300008108|Ga0114341_10111271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4067 | Open in IMG/M |
| 3300008108|Ga0114341_10260134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300008110|Ga0114343_1091469 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300008114|Ga0114347_1240433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300008116|Ga0114350_1002364 | Not Available | 12906 | Open in IMG/M |
| 3300008116|Ga0114350_1070165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
| 3300008116|Ga0114350_1158309 | Not Available | 619 | Open in IMG/M |
| 3300008117|Ga0114351_1339864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300009155|Ga0114968_10206464 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300009155|Ga0114968_10542575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300009419|Ga0114982_1176201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300010157|Ga0114964_10043307 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2395 | Open in IMG/M |
| 3300010370|Ga0129336_10286346 | Not Available | 919 | Open in IMG/M |
| 3300010374|Ga0114986_1038518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300013005|Ga0164292_10925865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10192793 | Not Available | 1552 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10628133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300017761|Ga0181356_1177055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300017785|Ga0181355_1157238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300020172|Ga0211729_10032822 | Not Available | 872 | Open in IMG/M |
| 3300021962|Ga0222713_10302470 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300022407|Ga0181351_1049677 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300024343|Ga0244777_10054454 | All Organisms → Viruses → Predicted Viral | 2559 | Open in IMG/M |
| 3300024346|Ga0244775_10421825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300024348|Ga0244776_10400722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300024358|Ga0255173_1065132 | Not Available | 610 | Open in IMG/M |
| 3300024507|Ga0255176_1092604 | Not Available | 518 | Open in IMG/M |
| 3300024513|Ga0255144_1002914 | Not Available | 3093 | Open in IMG/M |
| 3300024514|Ga0255177_1044375 | Not Available | 764 | Open in IMG/M |
| 3300026473|Ga0255166_1090120 | Not Available | 560 | Open in IMG/M |
| 3300027121|Ga0255074_1028716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300027123|Ga0255090_1020314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
| 3300027131|Ga0255066_1040202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300027138|Ga0255064_1001918 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4180 | Open in IMG/M |
| 3300027155|Ga0255081_1043405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300027155|Ga0255081_1077122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300027193|Ga0208800_1019289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300027219|Ga0208167_1041463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300027223|Ga0208169_1031782 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300027239|Ga0208807_1019848 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300027247|Ga0208679_1042656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300027261|Ga0208933_1071902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300027281|Ga0208440_1036011 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300027314|Ga0208811_1000768 | Not Available | 8099 | Open in IMG/M |
| 3300027508|Ga0255072_1119382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300027529|Ga0255077_1018179 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300027581|Ga0209651_1003231 | Not Available | 5654 | Open in IMG/M |
| 3300027601|Ga0255079_1099126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300027601|Ga0255079_1106295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300027631|Ga0208133_1016053 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1979 | Open in IMG/M |
| 3300027659|Ga0208975_1130228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300027697|Ga0209033_1096502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300027720|Ga0209617_10392328 | Not Available | 508 | Open in IMG/M |
| 3300027732|Ga0209442_1187792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300027754|Ga0209596_1347024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300027772|Ga0209768_10001676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14103 | Open in IMG/M |
| 3300027793|Ga0209972_10328120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300027806|Ga0209985_10434025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300027892|Ga0209550_10846133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300027969|Ga0209191_1294836 | Not Available | 603 | Open in IMG/M |
| 3300031758|Ga0315907_10084670 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2731 | Open in IMG/M |
| 3300031787|Ga0315900_10557011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300031857|Ga0315909_10377273 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300031857|Ga0315909_10441916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300031857|Ga0315909_10503747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300031857|Ga0315909_10557419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300031951|Ga0315904_10500038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
| 3300031963|Ga0315901_10972026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300032050|Ga0315906_10732864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300032050|Ga0315906_11103226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300032050|Ga0315906_11148734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300033557|Ga0316617_100403021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1207 | Open in IMG/M |
| 3300033557|Ga0316617_100851819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300033980|Ga0334981_0094586 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| 3300034018|Ga0334985_0173897 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1448 | Open in IMG/M |
| 3300034061|Ga0334987_0051591 | All Organisms → Viruses → Predicted Viral | 3410 | Open in IMG/M |
| 3300034082|Ga0335020_0441311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300034093|Ga0335012_0549649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300034104|Ga0335031_0287711 | Not Available | 1074 | Open in IMG/M |
| 3300034106|Ga0335036_0573814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300034166|Ga0335016_0243263 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300034272|Ga0335049_0430399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 19.42% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.62% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.85% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.94% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.97% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.97% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.97% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.97% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027223 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_101556461 | 3300000756 | Freshwater And Sediment | MSFLENENEMVIDATYSEIGAMLVEDWVNSNLDEGQLFADFRFAEMADNNYLKGRFNQ |
| Ga0070374_102101073 | 3300005517 | Freshwater Lake | MSFLENENEMVIDATYSEIGAMLVEDWVNANLDEGQLFADYRFAEM |
| Ga0078894_109532891 | 3300005662 | Freshwater Lake | MSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFA |
| Ga0078894_110897641 | 3300005662 | Freshwater Lake | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYRFAEMC |
| Ga0070744_100022311 | 3300006484 | Estuarine | VSSFLENENEMLIDAIYSEIGEQLVEDWVNSNLDEGQLYADWCV |
| Ga0070744_100705682 | 3300006484 | Estuarine | MSSFLENENEMLIDAIYSEIGEQLVEDWVNSNLDEGQLYADWCV |
| Ga0070744_101501731 | 3300006484 | Estuarine | MSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYA |
| Ga0102881_11519752 | 3300007551 | Estuarine | MSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEG |
| Ga0102821_11002441 | 3300007557 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLK |
| Ga0102920_12223782 | 3300007600 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAE |
| Ga0102901_12223001 | 3300007634 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLFADFRFAEM |
| Ga0102906_11215041 | 3300007637 | Estuarine | MSFLENENQMVIDLTYQEIGEMLVEDWVNSNLDEGQLFADFRFAEM |
| Ga0102900_10629771 | 3300007651 | Estuarine | MSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQLYADFRFAEMSDSNYLKGRFNLFY |
| Ga0102908_10508382 | 3300007665 | Estuarine | MSFLENENQMVIDAIYSEIGEQLVEDWVNSNLDEGQMYADYRFAEMSSDNYIK |
| Ga0102908_11016232 | 3300007665 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDSNYLK |
| Ga0102893_10983531 | 3300008052 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLKGRFNLFY |
| Ga0102893_11662791 | 3300008052 | Estuarine | MSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQLFADYRFAEMADNNYLKGRFNLFY |
| Ga0114340_11394591 | 3300008107 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQ |
| Ga0114340_12250871 | 3300008107 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYCFADMAESNYLKGRFNQ |
| Ga0114341_100326239 | 3300008108 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYCFADMAESN |
| Ga0114341_101112715 | 3300008108 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQFYADKCFAEMWLLKMESL* |
| Ga0114341_102601342 | 3300008108 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWCFA |
| Ga0114343_10914692 | 3300008110 | Freshwater, Plankton | MSFLENENQMVIDAEYSAIGEQLVEDWINSNLDEGVM |
| Ga0114347_12404332 | 3300008114 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYADWCFADMAES |
| Ga0114350_100236435 | 3300008116 | Freshwater, Plankton | MSKESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMY |
| Ga0114350_10701652 | 3300008116 | Freshwater, Plankton | MASFLENENQMVIDAIYSEIGDHLVEQWIQSNLDEGQLYADYCFAQMSDDNYIKGRFN |
| Ga0114350_11583091 | 3300008116 | Freshwater, Plankton | MAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMY |
| Ga0114351_13398642 | 3300008117 | Freshwater, Plankton | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWCFADMA |
| Ga0114968_102064643 | 3300009155 | Freshwater Lake | MSFLENENQMVIDATYSEIGDMLVEDWVNANLDEGQLYADFRFAEMAD |
| Ga0114968_105425753 | 3300009155 | Freshwater Lake | MSSFLENENEMVIDMTYSEIGEMLVEDWINSNLDEGQLYADWCVANMASSNYLKG |
| Ga0114982_11762011 | 3300009419 | Deep Subsurface | MAEQSFLENENQMVIDACYSEIGEMLVEDWVQSNLDEGQMYADFR |
| Ga0114964_100433077 | 3300010157 | Freshwater Lake | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFA |
| Ga0129336_102863462 | 3300010370 | Freshwater To Marine Saline Gradient | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWCFADMAERK* |
| Ga0114986_10385181 | 3300010374 | Deep Subsurface | MSFLENENQMVIDAIYSEIGEQLVEDWTNSNLDEGQMYADWCFADMSGDNYIKGR |
| Ga0164292_109258652 | 3300013005 | Freshwater | MSFLENENQMVIDAIYSDIGEMLVEDWVNSNLDEGQMYADFRFAE |
| (restricted) Ga0172372_101927931 | 3300013132 | Freshwater | MSSFLENENQMLIDAEYSAIGDHLVQEWINSNLDEGVYYADKCFAEMCDSDYLK |
| (restricted) Ga0172376_106281332 | 3300014720 | Freshwater | MESFLENENQMVIDAELSAIGDHLVQEWINSNLDEGVYYADKCFAEMCEST |
| Ga0181356_11770551 | 3300017761 | Freshwater Lake | MSSFLENENEMLIDAIYSEIGEQLVEDWINSNLDEGQLYADWCVADMSNSNY |
| Ga0181355_11572381 | 3300017785 | Freshwater Lake | MSFLENENQMVIDATYSEIGDMLVEDWVQSNLDEGQMYADYRFAEM |
| Ga0211729_100328223 | 3300020172 | Freshwater | MSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADFRFAEMSD |
| Ga0222713_103024701 | 3300021962 | Estuarine Water | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGELYADYC |
| Ga0181351_10496774 | 3300022407 | Freshwater Lake | MSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFAEMSDSNYLKGRFNLFY |
| Ga0244777_100544541 | 3300024343 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEG |
| Ga0244775_104218252 | 3300024346 | Estuarine | MSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYA |
| Ga0244776_104007222 | 3300024348 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSD |
| Ga0255173_10651321 | 3300024358 | Freshwater | MAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADF |
| Ga0255176_10926041 | 3300024507 | Freshwater | MAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADFRFAEMSNDNYIKGR |
| Ga0255144_10029147 | 3300024513 | Freshwater | MAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADFRFAEMSNDNYIKGRFNQ |
| Ga0255177_10443751 | 3300024514 | Freshwater | MAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADFRFAEMSNDNYIKGRF |
| Ga0255166_10901201 | 3300026473 | Freshwater | MSKESFLENENQMVIDAILSEIGEQLVEDWINNNLDEGQLYSDWCIANMSDDNYLKGRFN |
| Ga0255074_10287161 | 3300027121 | Freshwater | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNY |
| Ga0255090_10203141 | 3300027123 | Freshwater | MSFLENENQMVIDATYSEIGDMLVEDWVNANLDEGQLYA |
| Ga0255066_10402021 | 3300027131 | Freshwater | MSFLENENQMVIDATYSEIGDMLVEDWVNANLDEGQLYADFRFAEMADSNYLKGRFN |
| Ga0255064_10019181 | 3300027138 | Freshwater | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLYADYR |
| Ga0255081_10434052 | 3300027155 | Freshwater | MSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDDNYIKGRFNQFY |
| Ga0255081_10771222 | 3300027155 | Freshwater | MSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSD |
| Ga0208800_10192892 | 3300027193 | Estuarine | MSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYAD |
| Ga0208167_10414631 | 3300027219 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFA |
| Ga0208169_10317822 | 3300027223 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLKG |
| Ga0208807_10198481 | 3300027239 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNN |
| Ga0208679_10426562 | 3300027247 | Estuarine | MSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQLYADFRFAEMSDSNYL |
| Ga0208933_10719021 | 3300027261 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMY |
| Ga0208440_10360112 | 3300027281 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMAD |
| Ga0208811_10007681 | 3300027314 | Estuarine | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFA |
| Ga0255072_11193821 | 3300027508 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYR |
| Ga0255077_10181792 | 3300027529 | Freshwater | MSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDDNYIKGRFN |
| Ga0209651_10032311 | 3300027581 | Freshwater Lake | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFAEMADNNYLKGRFNLFY |
| Ga0255079_10991261 | 3300027601 | Freshwater | MSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLKGRFN |
| Ga0255079_11062951 | 3300027601 | Freshwater | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQL |
| Ga0208133_10160531 | 3300027631 | Estuarine | MSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQL |
| Ga0208975_11302282 | 3300027659 | Freshwater Lentic | MSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQMFADFRFAEMSDSNYLKGR |
| Ga0209033_10965022 | 3300027697 | Freshwater Lake | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYADYCFAE |
| Ga0209617_103923282 | 3300027720 | Freshwater And Sediment | VSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYAD |
| Ga0209442_11877921 | 3300027732 | Freshwater Lake | MSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFA |
| Ga0209596_13470242 | 3300027754 | Freshwater Lake | MASFLENENQMVIDAIYSDIGEMLVEDWANSNLDEGQLYADFRFAEMSDSN |
| Ga0209768_100016761 | 3300027772 | Freshwater Lake | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMF |
| Ga0209972_103281202 | 3300027793 | Freshwater Lake | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYAD |
| Ga0209985_104340252 | 3300027806 | Freshwater Lake | MASFLEDENQMVIDAEMSAIADQLLDDWIQSNLDEGQYYADKCFAEM |
| Ga0209550_108461331 | 3300027892 | Freshwater Lake | MSFLEDENQMVIDATYSEIGDMLVEDWVQSNLDEGQMYADFRFAEMADNNYLKGRFN |
| Ga0209191_12948361 | 3300027969 | Freshwater Lake | MSFLENENEMVIDATYSEIGAMLVEDWVNSNLDEGQLFADF |
| Ga0315907_100846707 | 3300031758 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQFYADY |
| Ga0315900_105570111 | 3300031787 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDESVY |
| Ga0315909_103772733 | 3300031857 | Freshwater | MAESFLENENQMVIDAIYHEIGEQLVEDWVNSNLDEGQMYADYRFAEMS |
| Ga0315909_104419162 | 3300031857 | Freshwater | MSFLEDENQMVIDAIYHEIGEQLVEDWVNSNLDEGQMYADYRFAEMS |
| Ga0315909_105037471 | 3300031857 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQFYADKCFAE |
| Ga0315909_105574191 | 3300031857 | Freshwater | MSFLENENQMVIDAEYSAIGEQLVEDWVNSNLDEGVFYADKCFAE |
| Ga0315904_105000381 | 3300031951 | Freshwater | MSFLENENQMVIDAIYQEIGEQLVEDWVQSNLDEGQMYADYRFAE |
| Ga0315901_109720261 | 3300031963 | Freshwater | MSFLENENQMVIDAIYSEIGEMLVEDWVNANLDEGQMYADFRFAEMSDDNYIKGRFNQFY |
| Ga0315906_107328642 | 3300032050 | Freshwater | MSFLEDENQMVIDAEYSYIGEQLVEDWVNSNLDEGQFYADKCFAEMCESNYLK |
| Ga0315906_111032262 | 3300032050 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWC |
| Ga0315906_111487342 | 3300032050 | Freshwater | MASFLENENQMVIDAIYSEIGDHLVEQWIQSNLDEGQLYADYCFAQMS |
| Ga0316617_1004030212 | 3300033557 | Soil | MSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDDNYI |
| Ga0316617_1008518191 | 3300033557 | Soil | MSFLENENEMVIDAIYHEIGEQLVEDWVNSNLDEGQLYADF |
| Ga0334981_0094586_2_178 | 3300033980 | Freshwater | MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLFADFRFAEMSDNNYLKGRFNQF |
| Ga0334985_0173897_3_107 | 3300034018 | Freshwater | MSFLEDENQMVIDAEYSYIGEQLVEEWVNSNLDEG |
| Ga0334987_0051591_1_126 | 3300034061 | Freshwater | MSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADFR |
| Ga0335020_0441311_447_623 | 3300034082 | Freshwater | MAKTSFLENENQMLIDATLSEIGEELVEDWINSNLDEVQLYADWCIADKSGSNYLKGRF |
| Ga0335012_0549649_418_540 | 3300034093 | Freshwater | MSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQMFADF |
| Ga0335031_0287711_947_1072 | 3300034104 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGELYADYR |
| Ga0335036_0573814_540_689 | 3300034106 | Freshwater | MSSFLENENQMLIDAIYSEIGEQLVEDWVNSNLDEGQLYADWCVADMSNS |
| Ga0335056_0182972_1_165 | 3300034120 | Freshwater | MSFLENENQMVIDATLSEIGEMLVEDWINSNLDEGELYSDWRIADMSDSNYLKGR |
| Ga0335016_0243263_977_1138 | 3300034166 | Freshwater | MSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYCFADMAESNYLKG |
| Ga0335049_0430399_702_857 | 3300034272 | Freshwater | MSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADFRFAEMADSNYL |
| ⦗Top⦘ |