NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099312

Metagenome Family F099312

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099312
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 48 residues
Representative Sequence MSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLFADFRFAEM
Number of Associated Samples 84
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 99.02 %
% of genes near scaffold ends (potentially truncated) 97.09 %
% of genes from short scaffolds (< 2000 bps) 86.41 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (62.136 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(19.417 % of family members)
Environment Ontology (ENVO) Unclassified
(36.893 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(49.515 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.11%    β-sheet: 0.00%    Coil/Unstructured: 41.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF06067DUF932 12.62
PF02467Whib 0.97
PF02675AdoMet_dc 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.58 %
UnclassifiedrootN/A19.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000756|JGI12421J11937_10155646Not Available561Open in IMG/M
3300005517|Ga0070374_10210107Not Available1000Open in IMG/M
3300005662|Ga0078894_10953289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300005662|Ga0078894_11089764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300006484|Ga0070744_10002231Not Available5870Open in IMG/M
3300006484|Ga0070744_10070568All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300006484|Ga0070744_10150173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300007551|Ga0102881_1151975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300007557|Ga0102821_1100244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300007600|Ga0102920_1222378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300007634|Ga0102901_1222300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300007637|Ga0102906_1121504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage718Open in IMG/M
3300007651|Ga0102900_1062977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300007665|Ga0102908_1050838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300007665|Ga0102908_1101623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300008052|Ga0102893_1098353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage869Open in IMG/M
3300008052|Ga0102893_1166279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300008107|Ga0114340_1139459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300008107|Ga0114340_1225087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300008108|Ga0114341_10032623Not Available3546Open in IMG/M
3300008108|Ga0114341_10111271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4067Open in IMG/M
3300008108|Ga0114341_10260134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
3300008110|Ga0114343_1091469All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300008114|Ga0114347_1240433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300008116|Ga0114350_1002364Not Available12906Open in IMG/M
3300008116|Ga0114350_1070165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1198Open in IMG/M
3300008116|Ga0114350_1158309Not Available619Open in IMG/M
3300008117|Ga0114351_1339864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300009155|Ga0114968_10206464All Organisms → Viruses → Predicted Viral1136Open in IMG/M
3300009155|Ga0114968_10542575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300009419|Ga0114982_1176201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300010157|Ga0114964_10043307All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2395Open in IMG/M
3300010370|Ga0129336_10286346Not Available919Open in IMG/M
3300010374|Ga0114986_1038518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300013005|Ga0164292_10925865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
(restricted) 3300013132|Ga0172372_10192793Not Available1552Open in IMG/M
(restricted) 3300014720|Ga0172376_10628133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300017761|Ga0181356_1177055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300017785|Ga0181355_1157238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage915Open in IMG/M
3300020172|Ga0211729_10032822Not Available872Open in IMG/M
3300021962|Ga0222713_10302470All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300022407|Ga0181351_1049677All Organisms → Viruses → Predicted Viral1754Open in IMG/M
3300024343|Ga0244777_10054454All Organisms → Viruses → Predicted Viral2559Open in IMG/M
3300024346|Ga0244775_10421825All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1096Open in IMG/M
3300024348|Ga0244776_10400722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300024358|Ga0255173_1065132Not Available610Open in IMG/M
3300024507|Ga0255176_1092604Not Available518Open in IMG/M
3300024513|Ga0255144_1002914Not Available3093Open in IMG/M
3300024514|Ga0255177_1044375Not Available764Open in IMG/M
3300026473|Ga0255166_1090120Not Available560Open in IMG/M
3300027121|Ga0255074_1028716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300027123|Ga0255090_1020314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1164Open in IMG/M
3300027131|Ga0255066_1040202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300027138|Ga0255064_1001918All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon4180Open in IMG/M
3300027155|Ga0255081_1043405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300027155|Ga0255081_1077122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300027193|Ga0208800_1019289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300027219|Ga0208167_1041463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage800Open in IMG/M
3300027223|Ga0208169_1031782All Organisms → Viruses → Predicted Viral1005Open in IMG/M
3300027239|Ga0208807_1019848All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300027247|Ga0208679_1042656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300027261|Ga0208933_1071902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300027281|Ga0208440_1036011All Organisms → Viruses → Predicted Viral1126Open in IMG/M
3300027314|Ga0208811_1000768Not Available8099Open in IMG/M
3300027508|Ga0255072_1119382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300027529|Ga0255077_1018179All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300027581|Ga0209651_1003231Not Available5654Open in IMG/M
3300027601|Ga0255079_1099126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300027601|Ga0255079_1106295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300027631|Ga0208133_1016053All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1979Open in IMG/M
3300027659|Ga0208975_1130228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300027697|Ga0209033_1096502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage976Open in IMG/M
3300027720|Ga0209617_10392328Not Available508Open in IMG/M
3300027732|Ga0209442_1187792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300027754|Ga0209596_1347024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300027772|Ga0209768_10001676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes14103Open in IMG/M
3300027793|Ga0209972_10328120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300027806|Ga0209985_10434025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300027892|Ga0209550_10846133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300027969|Ga0209191_1294836Not Available603Open in IMG/M
3300031758|Ga0315907_10084670All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2731Open in IMG/M
3300031787|Ga0315900_10557011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage851Open in IMG/M
3300031857|Ga0315909_10377273All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300031857|Ga0315909_10441916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage917Open in IMG/M
3300031857|Ga0315909_10503747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300031857|Ga0315909_10557419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300031951|Ga0315904_10500038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1072Open in IMG/M
3300031963|Ga0315901_10972026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300032050|Ga0315906_10732864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300032050|Ga0315906_11103226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300032050|Ga0315906_11148734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300033557|Ga0316617_100403021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1207Open in IMG/M
3300033557|Ga0316617_100851819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300033980|Ga0334981_0094586All Organisms → Viruses → Predicted Viral1486Open in IMG/M
3300034018|Ga0334985_0173897All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1448Open in IMG/M
3300034061|Ga0334987_0051591All Organisms → Viruses → Predicted Viral3410Open in IMG/M
3300034082|Ga0335020_0441311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300034093|Ga0335012_0549649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300034104|Ga0335031_0287711Not Available1074Open in IMG/M
3300034106|Ga0335036_0573814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300034166|Ga0335016_0243263All Organisms → Viruses → Predicted Viral1139Open in IMG/M
3300034272|Ga0335049_0430399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage857Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine19.42%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater14.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater12.62%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton10.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater10.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.85%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine4.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.94%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.94%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.97%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.97%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.97%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.97%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010374Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024358Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8dEnvironmentalOpen in IMG/M
3300024507Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300024514Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027155Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027219Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027239Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027247Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027261Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027314Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027529Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027601Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12421J11937_1015564613300000756Freshwater And SedimentMSFLENENEMVIDATYSEIGAMLVEDWVNSNLDEGQLFADFRFAEMADNNYLKGRFNQ
Ga0070374_1021010733300005517Freshwater LakeMSFLENENEMVIDATYSEIGAMLVEDWVNANLDEGQLFADYRFAEM
Ga0078894_1095328913300005662Freshwater LakeMSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFA
Ga0078894_1108976413300005662Freshwater LakeMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYRFAEMC
Ga0070744_1000223113300006484EstuarineVSSFLENENEMLIDAIYSEIGEQLVEDWVNSNLDEGQLYADWCV
Ga0070744_1007056823300006484EstuarineMSSFLENENEMLIDAIYSEIGEQLVEDWVNSNLDEGQLYADWCV
Ga0070744_1015017313300006484EstuarineMSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYA
Ga0102881_115197523300007551EstuarineMSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEG
Ga0102821_110024413300007557EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLK
Ga0102920_122237823300007600EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAE
Ga0102901_122230013300007634EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLFADFRFAEM
Ga0102906_112150413300007637EstuarineMSFLENENQMVIDLTYQEIGEMLVEDWVNSNLDEGQLFADFRFAEM
Ga0102900_106297713300007651EstuarineMSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQLYADFRFAEMSDSNYLKGRFNLFY
Ga0102908_105083823300007665EstuarineMSFLENENQMVIDAIYSEIGEQLVEDWVNSNLDEGQMYADYRFAEMSSDNYIK
Ga0102908_110162323300007665EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDSNYLK
Ga0102893_109835313300008052EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLKGRFNLFY
Ga0102893_116627913300008052EstuarineMSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQLFADYRFAEMADNNYLKGRFNLFY
Ga0114340_113945913300008107Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQ
Ga0114340_122508713300008107Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYCFADMAESNYLKGRFNQ
Ga0114341_1003262393300008108Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYCFADMAESN
Ga0114341_1011127153300008108Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQFYADKCFAEMWLLKMESL*
Ga0114341_1026013423300008108Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWCFA
Ga0114343_109146923300008110Freshwater, PlanktonMSFLENENQMVIDAEYSAIGEQLVEDWINSNLDEGVM
Ga0114347_124043323300008114Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYADWCFADMAES
Ga0114350_1002364353300008116Freshwater, PlanktonMSKESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMY
Ga0114350_107016523300008116Freshwater, PlanktonMASFLENENQMVIDAIYSEIGDHLVEQWIQSNLDEGQLYADYCFAQMSDDNYIKGRFN
Ga0114350_115830913300008116Freshwater, PlanktonMAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMY
Ga0114351_133986423300008117Freshwater, PlanktonMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWCFADMA
Ga0114968_1020646433300009155Freshwater LakeMSFLENENQMVIDATYSEIGDMLVEDWVNANLDEGQLYADFRFAEMAD
Ga0114968_1054257533300009155Freshwater LakeMSSFLENENEMVIDMTYSEIGEMLVEDWINSNLDEGQLYADWCVANMASSNYLKG
Ga0114982_117620113300009419Deep SubsurfaceMAEQSFLENENQMVIDACYSEIGEMLVEDWVQSNLDEGQMYADFR
Ga0114964_1004330773300010157Freshwater LakeMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFA
Ga0129336_1028634623300010370Freshwater To Marine Saline GradientMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWCFADMAERK*
Ga0114986_103851813300010374Deep SubsurfaceMSFLENENQMVIDAIYSEIGEQLVEDWTNSNLDEGQMYADWCFADMSGDNYIKGR
Ga0164292_1092586523300013005FreshwaterMSFLENENQMVIDAIYSDIGEMLVEDWVNSNLDEGQMYADFRFAE
(restricted) Ga0172372_1019279313300013132FreshwaterMSSFLENENQMLIDAEYSAIGDHLVQEWINSNLDEGVYYADKCFAEMCDSDYLK
(restricted) Ga0172376_1062813323300014720FreshwaterMESFLENENQMVIDAELSAIGDHLVQEWINSNLDEGVYYADKCFAEMCEST
Ga0181356_117705513300017761Freshwater LakeMSSFLENENEMLIDAIYSEIGEQLVEDWINSNLDEGQLYADWCVADMSNSNY
Ga0181355_115723813300017785Freshwater LakeMSFLENENQMVIDATYSEIGDMLVEDWVQSNLDEGQMYADYRFAEM
Ga0211729_1003282233300020172FreshwaterMSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADFRFAEMSD
Ga0222713_1030247013300021962Estuarine WaterMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGELYADYC
Ga0181351_104967743300022407Freshwater LakeMSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFAEMSDSNYLKGRFNLFY
Ga0244777_1005445413300024343EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEG
Ga0244775_1042182523300024346EstuarineMSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYA
Ga0244776_1040072223300024348EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSD
Ga0255173_106513213300024358FreshwaterMAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADF
Ga0255176_109260413300024507FreshwaterMAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADFRFAEMSNDNYIKGR
Ga0255144_100291473300024513FreshwaterMAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADFRFAEMSNDNYIKGRFNQ
Ga0255177_104437513300024514FreshwaterMAESFLENENQMVIDAIYQEIGEQLVEDWVNSNLDEGQMYADFRFAEMSNDNYIKGRF
Ga0255166_109012013300026473FreshwaterMSKESFLENENQMVIDAILSEIGEQLVEDWINNNLDEGQLYSDWCIANMSDDNYLKGRFN
Ga0255074_102871613300027121FreshwaterMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNY
Ga0255090_102031413300027123FreshwaterMSFLENENQMVIDATYSEIGDMLVEDWVNANLDEGQLYA
Ga0255066_104020213300027131FreshwaterMSFLENENQMVIDATYSEIGDMLVEDWVNANLDEGQLYADFRFAEMADSNYLKGRFN
Ga0255064_100191813300027138FreshwaterMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLYADYR
Ga0255081_104340523300027155FreshwaterMSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDDNYIKGRFNQFY
Ga0255081_107712223300027155FreshwaterMSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSD
Ga0208800_101928923300027193EstuarineMSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYAD
Ga0208167_104146313300027219EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFA
Ga0208169_103178223300027223EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLKG
Ga0208807_101984813300027239EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNN
Ga0208679_104265623300027247EstuarineMSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQLYADFRFAEMSDSNYL
Ga0208933_107190213300027261EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMY
Ga0208440_103601123300027281EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMAD
Ga0208811_100076813300027314EstuarineMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFA
Ga0255072_111938213300027508FreshwaterMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYR
Ga0255077_101817923300027529FreshwaterMSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDDNYIKGRFN
Ga0209651_100323113300027581Freshwater LakeMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFAEMADNNYLKGRFNLFY
Ga0255079_109912613300027601FreshwaterMSFLENENQMVIDATYSEIGEMLVEDWVNANLDEGQLFADYRFAEMADNNYLKGRFN
Ga0255079_110629513300027601FreshwaterMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQL
Ga0208133_101605313300027631EstuarineMSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQL
Ga0208975_113022823300027659Freshwater LenticMSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQMFADFRFAEMSDSNYLKGR
Ga0209033_109650223300027697Freshwater LakeMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYADYCFAE
Ga0209617_1039232823300027720Freshwater And SedimentVSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYAD
Ga0209442_118779213300027732Freshwater LakeMSFLENENEMVIDATYSEIGEMLVEDWVNANLDEGQLYADFRFA
Ga0209596_134702423300027754Freshwater LakeMASFLENENQMVIDAIYSDIGEMLVEDWANSNLDEGQLYADFRFAEMSDSN
Ga0209768_1000167613300027772Freshwater LakeMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQMF
Ga0209972_1032812023300027793Freshwater LakeMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQLYAD
Ga0209985_1043402523300027806Freshwater LakeMASFLEDENQMVIDAEMSAIADQLLDDWIQSNLDEGQYYADKCFAEM
Ga0209550_1084613313300027892Freshwater LakeMSFLEDENQMVIDATYSEIGDMLVEDWVQSNLDEGQMYADFRFAEMADNNYLKGRFN
Ga0209191_129483613300027969Freshwater LakeMSFLENENEMVIDATYSEIGAMLVEDWVNSNLDEGQLFADF
Ga0315907_1008467073300031758FreshwaterMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQFYADY
Ga0315900_1055701113300031787FreshwaterMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDESVY
Ga0315909_1037727333300031857FreshwaterMAESFLENENQMVIDAIYHEIGEQLVEDWVNSNLDEGQMYADYRFAEMS
Ga0315909_1044191623300031857FreshwaterMSFLEDENQMVIDAIYHEIGEQLVEDWVNSNLDEGQMYADYRFAEMS
Ga0315909_1050374713300031857FreshwaterMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQFYADKCFAE
Ga0315909_1055741913300031857FreshwaterMSFLENENQMVIDAEYSAIGEQLVEDWVNSNLDEGVFYADKCFAE
Ga0315904_1050003813300031951FreshwaterMSFLENENQMVIDAIYQEIGEQLVEDWVQSNLDEGQMYADYRFAE
Ga0315901_1097202613300031963FreshwaterMSFLENENQMVIDAIYSEIGEMLVEDWVNANLDEGQMYADFRFAEMSDDNYIKGRFNQFY
Ga0315906_1073286423300032050FreshwaterMSFLEDENQMVIDAEYSYIGEQLVEDWVNSNLDEGQFYADKCFAEMCESNYLK
Ga0315906_1110322623300032050FreshwaterMSFLENENQMVIDAEYSYIGEQLVEDWVNSNLDEGQMYADWC
Ga0315906_1114873423300032050FreshwaterMASFLENENQMVIDAIYSEIGDHLVEQWIQSNLDEGQLYADYCFAQMS
Ga0316617_10040302123300033557SoilMSFLENENQMVIDAIYSEIGEMLVEDWVNSNLDEGQMYADFRFAEMSDDNYI
Ga0316617_10085181913300033557SoilMSFLENENEMVIDAIYHEIGEQLVEDWVNSNLDEGQLYADF
Ga0334981_0094586_2_1783300033980FreshwaterMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLFADFRFAEMSDNNYLKGRFNQF
Ga0334985_0173897_3_1073300034018FreshwaterMSFLEDENQMVIDAEYSYIGEQLVEEWVNSNLDEG
Ga0334987_0051591_1_1263300034061FreshwaterMSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADFR
Ga0335020_0441311_447_6233300034082FreshwaterMAKTSFLENENQMLIDATLSEIGEELVEDWINSNLDEVQLYADWCIADKSGSNYLKGRF
Ga0335012_0549649_418_5403300034093FreshwaterMSFLENENEMVIDMTYSEIGAMLVEDWVNANLDEGQMFADF
Ga0335031_0287711_947_10723300034104FreshwaterMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGELYADYR
Ga0335036_0573814_540_6893300034106FreshwaterMSSFLENENQMLIDAIYSEIGEQLVEDWVNSNLDEGQLYADWCVADMSNS
Ga0335056_0182972_1_1653300034120FreshwaterMSFLENENQMVIDATLSEIGEMLVEDWINSNLDEGELYSDWRIADMSDSNYLKGR
Ga0335016_0243263_977_11383300034166FreshwaterMSFLENENQMVIDAEYSYIGEQLVEEWVNSNLDEGQLYADYCFADMAESNYLKG
Ga0335049_0430399_702_8573300034272FreshwaterMSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADFRFAEMADSNYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.