| Basic Information | |
|---|---|
| Family ID | F099272 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKCFTCGSELRLTMVKGKTYCFRCEADASMEQYGLVRPIKERTA |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 86.27 % |
| % of genes near scaffold ends (potentially truncated) | 25.24 % |
| % of genes from short scaffolds (< 2000 bps) | 59.22 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (80.583 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (16.505 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.874 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.816 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 11.11% Coil/Unstructured: 73.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00436 | SSB | 4.85 |
| PF02467 | Whib | 2.91 |
| PF02140 | Gal_Lectin | 2.91 |
| PF14550 | Peptidase_S78_2 | 1.94 |
| PF00145 | DNA_methylase | 0.97 |
| PF00850 | Hist_deacetyl | 0.97 |
| PF08282 | Hydrolase_3 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 4.85 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 4.85 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.94 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.97 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.97 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.97 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.97 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.41 % |
| Unclassified | root | N/A | 13.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002471|metazooDRAFT_1495786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1283 | Open in IMG/M |
| 3300004240|Ga0007787_10027854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2422 | Open in IMG/M |
| 3300004481|Ga0069718_14448251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 939 | Open in IMG/M |
| 3300005581|Ga0049081_10020156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2532 | Open in IMG/M |
| 3300005581|Ga0049081_10043809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1697 | Open in IMG/M |
| 3300005581|Ga0049081_10074851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1273 | Open in IMG/M |
| 3300005581|Ga0049081_10100792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1076 | Open in IMG/M |
| 3300005581|Ga0049081_10244274 | Not Available | 632 | Open in IMG/M |
| 3300005581|Ga0049081_10272085 | Not Available | 589 | Open in IMG/M |
| 3300005582|Ga0049080_10035639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1731 | Open in IMG/M |
| 3300005582|Ga0049080_10057433 | Not Available | 1341 | Open in IMG/M |
| 3300005582|Ga0049080_10084302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1086 | Open in IMG/M |
| 3300005582|Ga0049080_10252189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 575 | Open in IMG/M |
| 3300005584|Ga0049082_10012755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2856 | Open in IMG/M |
| 3300005585|Ga0049084_10192859 | Not Available | 698 | Open in IMG/M |
| 3300005662|Ga0078894_10437675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1179 | Open in IMG/M |
| 3300006484|Ga0070744_10195448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 576 | Open in IMG/M |
| 3300006802|Ga0070749_10026899 | All Organisms → cellular organisms → Bacteria | 3608 | Open in IMG/M |
| 3300006802|Ga0070749_10352153 | Not Available | 818 | Open in IMG/M |
| 3300007541|Ga0099848_1009662 | All Organisms → Viruses → Predicted Viral | 4279 | Open in IMG/M |
| 3300007541|Ga0099848_1032961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2151 | Open in IMG/M |
| 3300007734|Ga0104986_1954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60849 | Open in IMG/M |
| 3300008110|Ga0114343_1113515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 918 | Open in IMG/M |
| 3300008120|Ga0114355_1015644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8107 | Open in IMG/M |
| 3300008266|Ga0114363_1038558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1966 | Open in IMG/M |
| 3300008266|Ga0114363_1179803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 672 | Open in IMG/M |
| 3300008450|Ga0114880_1250987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 552 | Open in IMG/M |
| 3300009155|Ga0114968_10220174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1091 | Open in IMG/M |
| 3300009158|Ga0114977_10053729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2491 | Open in IMG/M |
| 3300009158|Ga0114977_10610781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 587 | Open in IMG/M |
| 3300009159|Ga0114978_10015673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 5702 | Open in IMG/M |
| 3300009160|Ga0114981_10769115 | Not Available | 508 | Open in IMG/M |
| 3300009164|Ga0114975_10145248 | Not Available | 1358 | Open in IMG/M |
| 3300009180|Ga0114979_10057991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2422 | Open in IMG/M |
| 3300009180|Ga0114979_10355205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
| 3300009183|Ga0114974_10044463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 3002 | Open in IMG/M |
| 3300010354|Ga0129333_10000196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 42962 | Open in IMG/M |
| 3300010354|Ga0129333_10007749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10129 | Open in IMG/M |
| 3300010354|Ga0129333_10138614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2235 | Open in IMG/M |
| 3300010885|Ga0133913_11983906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1446 | Open in IMG/M |
| 3300012663|Ga0157203_1002970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 3635 | Open in IMG/M |
| 3300012666|Ga0157498_1040161 | Not Available | 719 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10034758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4306 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10072195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2570 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10043438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 4012 | Open in IMG/M |
| 3300013372|Ga0177922_10101983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1191 | Open in IMG/M |
| 3300013372|Ga0177922_10581893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 771 | Open in IMG/M |
| 3300013372|Ga0177922_10782384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1865 | Open in IMG/M |
| 3300013372|Ga0177922_10909722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 823 | Open in IMG/M |
| 3300013372|Ga0177922_11209679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 951 | Open in IMG/M |
| 3300013372|Ga0177922_11255105 | Not Available | 538 | Open in IMG/M |
| 3300014819|Ga0119954_1008730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2403 | Open in IMG/M |
| 3300017761|Ga0181356_1088654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1019 | Open in IMG/M |
| 3300017761|Ga0181356_1236427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 525 | Open in IMG/M |
| 3300017777|Ga0181357_1225996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 658 | Open in IMG/M |
| 3300017778|Ga0181349_1198998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 693 | Open in IMG/M |
| 3300017784|Ga0181348_1070020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1406 | Open in IMG/M |
| 3300019784|Ga0181359_1002332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5470 | Open in IMG/M |
| 3300019784|Ga0181359_1099654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1067 | Open in IMG/M |
| 3300020172|Ga0211729_11075273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 733 | Open in IMG/M |
| 3300020183|Ga0194115_10091951 | All Organisms → Viruses → Predicted Viral | 1721 | Open in IMG/M |
| 3300020183|Ga0194115_10288861 | Not Available | 755 | Open in IMG/M |
| 3300021961|Ga0222714_10002455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19599 | Open in IMG/M |
| 3300022200|Ga0196901_1036280 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
| 3300022407|Ga0181351_1074489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1367 | Open in IMG/M |
| 3300022752|Ga0214917_10003192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19200 | Open in IMG/M |
| 3300022752|Ga0214917_10017853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5989 | Open in IMG/M |
| 3300022752|Ga0214917_10062312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2414 | Open in IMG/M |
| 3300023174|Ga0214921_10015197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8805 | Open in IMG/M |
| 3300025732|Ga0208784_1029251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1758 | Open in IMG/M |
| 3300025732|Ga0208784_1071431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1052 | Open in IMG/M |
| 3300027608|Ga0208974_1011769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2826 | Open in IMG/M |
| 3300027608|Ga0208974_1011874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2809 | Open in IMG/M |
| 3300027608|Ga0208974_1074857 | Not Available | 934 | Open in IMG/M |
| 3300027659|Ga0208975_1104335 | Not Available | 821 | Open in IMG/M |
| 3300027659|Ga0208975_1152444 | Not Available | 644 | Open in IMG/M |
| 3300027733|Ga0209297_1114465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1143 | Open in IMG/M |
| 3300027759|Ga0209296_1028744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 3084 | Open in IMG/M |
| 3300027763|Ga0209088_10124106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1163 | Open in IMG/M |
| 3300027770|Ga0209086_10012858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5548 | Open in IMG/M |
| 3300027782|Ga0209500_10000649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29186 | Open in IMG/M |
| 3300027782|Ga0209500_10020950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 3808 | Open in IMG/M |
| 3300027782|Ga0209500_10435442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
| 3300027785|Ga0209246_10111115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1076 | Open in IMG/M |
| 3300027797|Ga0209107_10193909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1007 | Open in IMG/M |
| 3300027798|Ga0209353_10028813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2587 | Open in IMG/M |
| 3300027808|Ga0209354_10326633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 607 | Open in IMG/M |
| 3300027816|Ga0209990_10399732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 597 | Open in IMG/M |
| 3300028025|Ga0247723_1000879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18925 | Open in IMG/M |
| 3300028025|Ga0247723_1025648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1919 | Open in IMG/M |
| 3300029930|Ga0119944_1000988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5101 | Open in IMG/M |
| 3300031857|Ga0315909_10113746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2303 | Open in IMG/M |
| 3300031951|Ga0315904_10119167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2735 | Open in IMG/M |
| 3300033993|Ga0334994_0302910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 811 | Open in IMG/M |
| 3300034062|Ga0334995_0087725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2398 | Open in IMG/M |
| 3300034092|Ga0335010_0010653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7511 | Open in IMG/M |
| 3300034101|Ga0335027_0378405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 926 | Open in IMG/M |
| 3300034102|Ga0335029_0433819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 783 | Open in IMG/M |
| 3300034104|Ga0335031_0062461 | All Organisms → Viruses → Predicted Viral | 2668 | Open in IMG/M |
| 3300034104|Ga0335031_0064854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2615 | Open in IMG/M |
| 3300034106|Ga0335036_0376328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 920 | Open in IMG/M |
| 3300034279|Ga0335052_0141917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1422 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 16.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.74% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.91% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.97% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.97% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.97% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.97% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.97% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_14957863 | 3300002471 | Lake | MKCFTCGSEFRITFIKGKPYCFQCEIDVSYELYGLVRPIKKERAS* |
| Ga0007787_100278543 | 3300004240 | Freshwater Lake | MKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRTIKERTA* |
| Ga0069718_144482512 | 3300004481 | Sediment | MKCFTCGGELRLTMIKGKTYCFKCEADASMEQYGIVRPIKERNAS* |
| Ga0049081_100201564 | 3300005581 | Freshwater Lentic | MKCYLCGSEFRITFIQGKPYCFKCEVDVSLQAYGLVRQVKERTA* |
| Ga0049081_100438093 | 3300005581 | Freshwater Lentic | MKCFTCGSELRLTMIKGKTYCFRCEADASLEQYGLVRQIKERTA* |
| Ga0049081_100748512 | 3300005581 | Freshwater Lentic | MGGEKMKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRQIKERTA* |
| Ga0049081_101007922 | 3300005581 | Freshwater Lentic | MKCFTCGSELRLTMVKGKTYCFRCEADASMEQYGLVRPIKERTA* |
| Ga0049081_102442741 | 3300005581 | Freshwater Lentic | ELRLTVVKGKTYCFRCEVDASMEQYGIVRQIKERTA* |
| Ga0049081_102720851 | 3300005581 | Freshwater Lentic | NTMKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRTIKERTA* |
| Ga0049080_100356392 | 3300005582 | Freshwater Lentic | MKCFTCSSELRLTVVKGKTYCFRCEVDASMEQYGIVRQIKERTA* |
| Ga0049080_100574333 | 3300005582 | Freshwater Lentic | MKCFTCGSEFRITFVKGKPYCFQCEVDASFEAYGLVRPIRKERAS* |
| Ga0049080_100843023 | 3300005582 | Freshwater Lentic | MGGDKMKCFTCGSELRLTMVKGKTYCFRCEADASLQAFGVVRQIKERTA* |
| Ga0049080_102521892 | 3300005582 | Freshwater Lentic | MGGEKMKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRTIKERTA* |
| Ga0049082_100127553 | 3300005584 | Freshwater Lentic | MKCFTCGSELRLTMVKGKTYCFRCEADASMEQYGIVRQIKERTA* |
| Ga0049084_101928592 | 3300005585 | Freshwater Lentic | MKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRPIKERTA* |
| Ga0078894_104376752 | 3300005662 | Freshwater Lake | MKCFTCGSELRLTMIKGKTYCFKCEADASLQAYGVIRQIKERTA* |
| Ga0070744_101954482 | 3300006484 | Estuarine | MKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRQVKERTA* |
| Ga0070749_100268997 | 3300006802 | Aqueous | MKCSKCGSEFRITVVKGEFYCFECELDASLEAYGVVTPIKRRRTA* |
| Ga0070749_103521532 | 3300006802 | Aqueous | GGEKMKCFTCGSELRLTMIKGKTYCFRCEADASMEQYGLVRPRKERTA* |
| Ga0099848_10096628 | 3300007541 | Aqueous | MKCSKCGSEFRITVVKGEFYCFECELDASLEAYGVVTPIKKRRTA* |
| Ga0099848_10329615 | 3300007541 | Aqueous | MKCYLCGSEYRITMVKGKAYCFQCEVDVSLERYGLVRAIKEKRAS* |
| Ga0104986_19549 | 3300007734 | Freshwater | MGGKEMKCYTCGSELRLTMVKGKTYCFRCEVDASMEQYGIIRQTKERSAS* |
| Ga0114343_11135151 | 3300008110 | Freshwater, Plankton | MKCFTCGSELRLTMVKGKTYCFRCEADASLQAFGVVRQI |
| Ga0114355_10156449 | 3300008120 | Freshwater, Plankton | MKCYTCGSEFRITFVKGKPYCFLCEVDASMEQYGIVRQIKERTA* |
| Ga0114363_10385583 | 3300008266 | Freshwater, Plankton | MKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRTIKERTA* |
| Ga0114363_11798032 | 3300008266 | Freshwater, Plankton | MKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVVRQIKERTA* |
| Ga0114880_12509871 | 3300008450 | Freshwater Lake | RSYMGGKIMKCFTCGSEIRLTMINGKTYCFKCEADASMEQYGIIRPIKGRTA* |
| Ga0114968_102201743 | 3300009155 | Freshwater Lake | MKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGLVRTIK |
| Ga0114977_100537292 | 3300009158 | Freshwater Lake | MKFFTCGSELRLTIVKGKTYCFRCEADASMEQYGVVRQIKERTA* |
| Ga0114977_106107812 | 3300009158 | Freshwater Lake | MKCFTCGSKLRLTMVKGKTYCFKCEADASMEQYGIVRQIKERTA* |
| Ga0114978_100156737 | 3300009159 | Freshwater Lake | MKCFTCGSELRLTMVKGKTYCFRCEADASLQAFGVVRPIKERTA* |
| Ga0114981_107691152 | 3300009160 | Freshwater Lake | MKCFTCGSKLRLTMVKGKTYCFRCEADASLQAYGVIRQIKERTA* |
| Ga0114975_101452481 | 3300009164 | Freshwater Lake | DRSYMGGEKMKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRTIKERTA* |
| Ga0114979_100579916 | 3300009180 | Freshwater Lake | MKCFTCGSELRLTMVKGKTYCFRCEADASLQAFGVVRQIKERTA* |
| Ga0114979_103552052 | 3300009180 | Freshwater Lake | MKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGVVRQIKERTA* |
| Ga0114974_100444633 | 3300009183 | Freshwater Lake | MKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVIRQIKERTA* |
| Ga0129333_1000019647 | 3300010354 | Freshwater To Marine Saline Gradient | MKCYNCGSEYRLTLIKGKFYCFGCEADASLEAVGLVRPIKEKRTA* |
| Ga0129333_1000774913 | 3300010354 | Freshwater To Marine Saline Gradient | MKCSSCGSEFRITFVKGKPYCFQCEVDASFEAYGLVRPIKRERTA* |
| Ga0129333_101386143 | 3300010354 | Freshwater To Marine Saline Gradient | MKCYNCGSEYRLTLIKGKFYCFGCEADASLEAVGLVRPINKEKRTA* |
| Ga0133913_119839065 | 3300010885 | Freshwater Lake | MKCFTCGSELRLTMVEGKTYCFRCEADASLQAFGVVRQIKERTA* |
| Ga0157203_10029705 | 3300012663 | Freshwater | MKCYTCNSEFRITFVSGKPYCFRCEVDASLVAYGLVSSIKGGK* |
| Ga0157498_10401611 | 3300012666 | Freshwater, Surface Ice | FTCGSELRLTVVKGKTYCFRCEADASMEQYGIVQTIKERTA* |
| (restricted) Ga0172367_100347583 | 3300013126 | Freshwater | MKCSKCGSEFRITMVKGKFYCFECEVDASMEAVGLIRPIKERRAG* |
| (restricted) Ga0172367_100721953 | 3300013126 | Freshwater | MKCYLCGSEFRITFIQGKPYCFKCEADASLEAYGLVRQVKERTA* |
| (restricted) Ga0172373_100434381 | 3300013131 | Freshwater | MKCSKCGSEFRITMVKGKFYCFECEADASMEAVGLIRPIKERRAG* |
| Ga0177922_101019832 | 3300013372 | Freshwater | MKCFTCGSELRLTVVKGKTYCFRCEVDASMEQYGIVRQIKERTA* |
| Ga0177922_105818932 | 3300013372 | Freshwater | MKCFTCGSELRLTMVKEKTYCFRCEADASMEQYGVVRPIKERTA* |
| Ga0177922_107823842 | 3300013372 | Freshwater | MGGEKMKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVQTIKERTA* |
| Ga0177922_109097222 | 3300013372 | Freshwater | MKCYTCNSEFRITFIQGKPYCFRCEADASLQAYGVVRRIKE |
| Ga0177922_112096791 | 3300013372 | Freshwater | MKCYTCGSEFRITFVKGKPYCFICEVDASMEQYGIVRQIKERTA |
| Ga0177922_112551052 | 3300013372 | Freshwater | MKCFTCGSELRLTVVKGKIYCFRCEADASMEQYGIVRTIKERTA* |
| Ga0119954_10087302 | 3300014819 | Freshwater | MKCFSCGSEFRITFVKGKPYCFQCEVDASFEAYGLVRPIRKERAS* |
| Ga0181356_10886541 | 3300017761 | Freshwater Lake | MKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRQIRERT |
| Ga0181356_12364271 | 3300017761 | Freshwater Lake | MEGNKMKCYTCGSELRLTMIQGKTYCFRCEADASMQKYGI |
| Ga0181357_12259961 | 3300017777 | Freshwater Lake | MKCFTCGSELRLTVVKGKTYCFRCEVDASMEQYGIVRQIKERT |
| Ga0181349_11989982 | 3300017778 | Freshwater Lake | VSLVRKTRGGEKMKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVIRQIKEGTA |
| Ga0181348_10700202 | 3300017784 | Freshwater Lake | MRCFTCGSELRLTMIKGKTYCFRCEADASLQAFGVVRQIKERTA |
| Ga0181359_100233211 | 3300019784 | Freshwater Lake | MKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRPIKERTA |
| Ga0181359_10996542 | 3300019784 | Freshwater Lake | MGGEKMKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRTIKERTA |
| Ga0211729_110752732 | 3300020172 | Freshwater | MGGEKMKCFTCGSEIRLTMVKGKTYCFRCEADASMEQYGIIRPIKERTA |
| Ga0194115_100919513 | 3300020183 | Freshwater Lake | VKCYQCGSEFRLTIIKGKFYCFACEADASLEAVGLIRPIKEKRTA |
| Ga0194115_102888611 | 3300020183 | Freshwater Lake | MKCYQCGSQFRLTIIKGKFYCFACEADASLEAVGLVRPIKEKRTA |
| Ga0222714_1000245531 | 3300021961 | Estuarine Water | MKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRQVKERTA |
| Ga0196901_10362806 | 3300022200 | Aqueous | MKCSKCGSEFRITVVKGEFYCFECELDASLEAYGVITPIKRRRTA |
| Ga0181351_10744891 | 3300022407 | Freshwater Lake | MKCFTCGSELRLTMVKGKTYCFRCEADASMEQYGI |
| Ga0214917_100031927 | 3300022752 | Freshwater | MKCYTCGSEFRITFVKGKPYCFLCEVDASMEQYGLVRPIKERTA |
| Ga0214917_100178539 | 3300022752 | Freshwater | MKCSSCGSQYRITFVKGRPYCFQCEVDASFEAYGLIRPIKKERAS |
| Ga0214917_100623123 | 3300022752 | Freshwater | MKCFTCGSELRLTVVKGKTYCFKCEADASMEQYGIVRTIKERTA |
| Ga0214921_1001519711 | 3300023174 | Freshwater | MKCFTCGSELRLTMVKGKTYCFRCEADASMEQYGLVRPKKERTA |
| Ga0208784_10292513 | 3300025732 | Aqueous | MKCFTCGSEFRITFVKGKPYCFQCEVDASFEAYGLVRPIRKERAS |
| Ga0208784_10714311 | 3300025732 | Aqueous | MKCFTCGSEFRITFVKGKPYCFQCEVDASFEAYGLVRPIR |
| Ga0208974_10117693 | 3300027608 | Freshwater Lentic | MKCYLCGSEFRITFIQGKPYCFKCEADASLQAYGLVRTIKERTA |
| Ga0208974_10118744 | 3300027608 | Freshwater Lentic | MKCFTCGSELRLTMIKGKTYCFRCEADASLEQYGLVRQIKERTA |
| Ga0208974_10748572 | 3300027608 | Freshwater Lentic | MKCFTCSSELRLTVVKGKTYCFRCEVDASMEQYGIVRQIKERTA |
| Ga0208975_11043352 | 3300027659 | Freshwater Lentic | MKCFTCGSELRLTMVKGKTYCFRCEADASMEQYGLVRPIKERTA |
| Ga0208975_11524442 | 3300027659 | Freshwater Lentic | CGSELRLTVVKGKTYCFRCEADASMEQYGIVRQIKERTA |
| Ga0209297_11144652 | 3300027733 | Freshwater Lake | MKCFTCGSKLRLTMVKGKTYCFKCEADASMEQYGIVRQIKERTA |
| Ga0209296_10287443 | 3300027759 | Freshwater Lake | MKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVIRQIKERTA |
| Ga0209088_101241062 | 3300027763 | Freshwater Lake | MKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGVVRQIKERTA |
| Ga0209086_100128583 | 3300027770 | Freshwater Lake | MKCYTCGSEFRISFVKNKPYCFRCEADASLVALGIVRDKERENVG |
| Ga0209500_100006494 | 3300027782 | Freshwater Lake | MKCFTCGSELRLTMVEGKTYCFRCEADASLQAFGVVRQIKERTA |
| Ga0209500_100209501 | 3300027782 | Freshwater Lake | MKCFTCGSELRLTMVKGKTYCFRCEADASLQAFGVVRPIKERTA |
| Ga0209500_104354421 | 3300027782 | Freshwater Lake | MKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGVVRQIK |
| Ga0209246_101111153 | 3300027785 | Freshwater Lake | MEGNKMKCYTCGSELRLTMIQGKTYCFRCEADASMQKYGIVRPIKE |
| Ga0209107_101939091 | 3300027797 | Freshwater And Sediment | EKMKCFTCGSELRLTVVKGKTYCFRCEADASLQAFGVVRQIKERTA |
| Ga0209353_100288136 | 3300027798 | Freshwater Lake | MKCYTCGSELRLTMIQGKTYCFRCEADASMQKYGIVRPI |
| Ga0209354_103266331 | 3300027808 | Freshwater Lake | MEGNKMKCYTCGSELRLTMIQGKTYCFRCEADASMQKYGIVRPI |
| Ga0209990_103997321 | 3300027816 | Freshwater Lake | MKCYTCNSEYRITFVKGKPYCFRCEADASLVAYGIIKLIKGEKNHV |
| Ga0247723_10008796 | 3300028025 | Deep Subsurface Sediment | MKCYTCGSEFRITFIKGKPYCFRCEADASLVALGLVREERKNVG |
| Ga0247723_10256483 | 3300028025 | Deep Subsurface Sediment | MKCFTCGSELRLTMVKGKTYCFKCEVDASMEQYGLVRPIKERTA |
| Ga0119944_100098812 | 3300029930 | Aquatic | MKCYLCGSEFRITFIQGKPYCFKCEVDVSLQAYGLVRQVKERTA |
| Ga0315900_106999631 | 3300031787 | Freshwater | MCGGQLRITIIKGKAYCFRCELDASMEQYGLVRPIKER |
| Ga0315909_101137462 | 3300031857 | Freshwater | MKCFSCGSEFRITFVKGKPYCFQCEVDASFEAYGLVRPIKKERAS |
| Ga0315904_101191672 | 3300031951 | Freshwater | MKCYLCGSEFRITFIQGKPYCFKCEADASLEAYGLVRQVKERTA |
| Ga0334994_0302910_475_609 | 3300033993 | Freshwater | MKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVVRRIKERTA |
| Ga0334995_0087725_2246_2398 | 3300034062 | Freshwater | DMRGEEMKCYTCGSEFRITFIKGKPYCFRCEADASLVALGLVREERKNVG |
| Ga0335010_0010653_4866_5000 | 3300034092 | Freshwater | MKCYTCGSEFRITFVKGKPYCFMCEADASMEQYGIVRQIKERTA |
| Ga0335027_0378405_219_353 | 3300034101 | Freshwater | MKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVVRQIKERTA |
| Ga0335029_0433819_599_748 | 3300034102 | Freshwater | MGGKIMKCFTCGSELRLTVVKGKTYCFRCEADASMEQYGIVRTIKERTA |
| Ga0335031_0062461_793_927 | 3300034104 | Freshwater | MKCFTCGSELRLTVVQGKTYCFRCEADASMEQYGLVRPIKERTA |
| Ga0335031_0064854_3_125 | 3300034104 | Freshwater | MKCFTCGSELRLTVVQGKTYCFRCEVDASMEQYGLVRPIKE |
| Ga0335036_0376328_800_919 | 3300034106 | Freshwater | MKCYTCGSEFRITFVKGKPYCFLCEVDASMEQYGLVRPIK |
| Ga0335052_0141917_1277_1420 | 3300034279 | Freshwater | GKIMKCFTCGSELRLTMIKGKTYCFRCEADASLQAYGVVRRIKERTA |
| ⦗Top⦘ |