| Basic Information | |
|---|---|
| Family ID | F099251 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.12 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.136 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.010 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.660 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF12146 | Hydrolase_4 | 31.07 |
| PF01339 | CheB_methylest | 5.83 |
| PF01553 | Acyltransferase | 4.85 |
| PF12697 | Abhydrolase_6 | 1.94 |
| PF03705 | CheR_N | 1.94 |
| PF02673 | BacA | 0.97 |
| PF00365 | PFK | 0.97 |
| PF01739 | CheR | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 11.65 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 5.83 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.97 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.14 % |
| Unclassified | root | N/A | 37.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02HTI5E | Not Available | 537 | Open in IMG/M |
| 3300001593|JGI12635J15846_10322689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
| 3300001647|JGI20277J16323_100131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1323 | Open in IMG/M |
| 3300005439|Ga0070711_100429191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1078 | Open in IMG/M |
| 3300005537|Ga0070730_10861312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 569 | Open in IMG/M |
| 3300005921|Ga0070766_10069267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2027 | Open in IMG/M |
| 3300006577|Ga0074050_11192033 | Not Available | 740 | Open in IMG/M |
| 3300006605|Ga0074057_12336946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 898 | Open in IMG/M |
| 3300009545|Ga0105237_12719896 | Not Available | 506 | Open in IMG/M |
| 3300010048|Ga0126373_12625176 | Not Available | 562 | Open in IMG/M |
| 3300011120|Ga0150983_16559410 | Not Available | 518 | Open in IMG/M |
| 3300012198|Ga0137364_10335623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 3300012208|Ga0137376_11383368 | Not Available | 594 | Open in IMG/M |
| 3300014169|Ga0181531_10249051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1083 | Open in IMG/M |
| 3300014838|Ga0182030_10221891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2214 | Open in IMG/M |
| 3300016294|Ga0182041_11676503 | Not Available | 588 | Open in IMG/M |
| 3300017821|Ga0187812_1188328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 660 | Open in IMG/M |
| 3300017928|Ga0187806_1067798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1105 | Open in IMG/M |
| 3300017928|Ga0187806_1123050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 841 | Open in IMG/M |
| 3300017928|Ga0187806_1158053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 751 | Open in IMG/M |
| 3300017955|Ga0187817_10134780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1567 | Open in IMG/M |
| 3300017955|Ga0187817_10305695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1014 | Open in IMG/M |
| 3300017959|Ga0187779_10237894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1150 | Open in IMG/M |
| 3300017973|Ga0187780_10516594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 854 | Open in IMG/M |
| 3300018009|Ga0187884_10227687 | Not Available | 763 | Open in IMG/M |
| 3300018038|Ga0187855_10514807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 697 | Open in IMG/M |
| 3300018058|Ga0187766_10140241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1494 | Open in IMG/M |
| 3300018085|Ga0187772_11418035 | Not Available | 516 | Open in IMG/M |
| 3300018086|Ga0187769_10321336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1158 | Open in IMG/M |
| 3300018088|Ga0187771_10646656 | Not Available | 897 | Open in IMG/M |
| 3300018090|Ga0187770_10634934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 850 | Open in IMG/M |
| 3300019268|Ga0181514_1048404 | Not Available | 563 | Open in IMG/M |
| 3300021178|Ga0210408_10176501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 1696 | Open in IMG/M |
| 3300021388|Ga0213875_10467527 | Not Available | 604 | Open in IMG/M |
| 3300021405|Ga0210387_10469248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
| 3300021405|Ga0210387_11514507 | Not Available | 573 | Open in IMG/M |
| 3300021407|Ga0210383_11027826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 698 | Open in IMG/M |
| 3300021479|Ga0210410_10280048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1496 | Open in IMG/M |
| 3300022525|Ga0242656_1128219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 519 | Open in IMG/M |
| 3300022709|Ga0222756_1086284 | Not Available | 520 | Open in IMG/M |
| 3300024290|Ga0247667_1006762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2397 | Open in IMG/M |
| 3300025634|Ga0208589_1113410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 632 | Open in IMG/M |
| 3300025898|Ga0207692_10472891 | Not Available | 792 | Open in IMG/M |
| 3300025903|Ga0207680_11282171 | Not Available | 521 | Open in IMG/M |
| 3300026998|Ga0208369_1005905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1074 | Open in IMG/M |
| 3300027080|Ga0208237_1032279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 790 | Open in IMG/M |
| 3300027297|Ga0208241_1015829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1097 | Open in IMG/M |
| 3300027855|Ga0209693_10313648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 764 | Open in IMG/M |
| 3300027857|Ga0209166_10573542 | Not Available | 575 | Open in IMG/M |
| 3300027869|Ga0209579_10115505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1425 | Open in IMG/M |
| 3300027884|Ga0209275_10878474 | Not Available | 517 | Open in IMG/M |
| 3300027889|Ga0209380_10356079 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300028381|Ga0268264_11346460 | Not Available | 724 | Open in IMG/M |
| 3300028747|Ga0302219_10272824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 657 | Open in IMG/M |
| 3300028791|Ga0307290_10288575 | Not Available | 601 | Open in IMG/M |
| 3300030057|Ga0302176_10374771 | Not Available | 573 | Open in IMG/M |
| 3300030399|Ga0311353_10800478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 804 | Open in IMG/M |
| 3300030503|Ga0311370_10336070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1933 | Open in IMG/M |
| 3300030520|Ga0311372_10687609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1432 | Open in IMG/M |
| 3300031234|Ga0302325_12777824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 574 | Open in IMG/M |
| 3300031544|Ga0318534_10072612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 1949 | Open in IMG/M |
| 3300031549|Ga0318571_10375594 | Not Available | 550 | Open in IMG/M |
| 3300031572|Ga0318515_10106854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1471 | Open in IMG/M |
| 3300031572|Ga0318515_10425902 | Not Available | 710 | Open in IMG/M |
| 3300031573|Ga0310915_11121854 | Not Available | 546 | Open in IMG/M |
| 3300031679|Ga0318561_10189950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1112 | Open in IMG/M |
| 3300031681|Ga0318572_10034912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2638 | Open in IMG/M |
| 3300031682|Ga0318560_10630199 | Not Available | 580 | Open in IMG/M |
| 3300031708|Ga0310686_116726981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1251 | Open in IMG/M |
| 3300031736|Ga0318501_10332208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 815 | Open in IMG/M |
| 3300031747|Ga0318502_10093449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1658 | Open in IMG/M |
| 3300031751|Ga0318494_10613122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 636 | Open in IMG/M |
| 3300031764|Ga0318535_10159902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1005 | Open in IMG/M |
| 3300031764|Ga0318535_10511901 | Not Available | 533 | Open in IMG/M |
| 3300031765|Ga0318554_10364239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 821 | Open in IMG/M |
| 3300031765|Ga0318554_10712096 | Not Available | 563 | Open in IMG/M |
| 3300031796|Ga0318576_10115495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1235 | Open in IMG/M |
| 3300031805|Ga0318497_10508361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
| 3300031821|Ga0318567_10324127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300031859|Ga0318527_10373789 | Not Available | 607 | Open in IMG/M |
| 3300031860|Ga0318495_10211861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 871 | Open in IMG/M |
| 3300031880|Ga0318544_10267157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 663 | Open in IMG/M |
| 3300031910|Ga0306923_11432866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 726 | Open in IMG/M |
| 3300031945|Ga0310913_10918380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 615 | Open in IMG/M |
| 3300031954|Ga0306926_12678294 | Not Available | 542 | Open in IMG/M |
| 3300031955|Ga0316035_113514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 631 | Open in IMG/M |
| 3300032044|Ga0318558_10331544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 754 | Open in IMG/M |
| 3300032065|Ga0318513_10130386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1191 | Open in IMG/M |
| 3300032074|Ga0308173_10766080 | Not Available | 886 | Open in IMG/M |
| 3300032076|Ga0306924_11713721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 658 | Open in IMG/M |
| 3300032076|Ga0306924_12550289 | Not Available | 511 | Open in IMG/M |
| 3300032090|Ga0318518_10343194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 766 | Open in IMG/M |
| 3300032205|Ga0307472_101777634 | Not Available | 611 | Open in IMG/M |
| 3300032261|Ga0306920_102211877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 764 | Open in IMG/M |
| 3300032515|Ga0348332_12688863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 722 | Open in IMG/M |
| 3300032770|Ga0335085_11575554 | Not Available | 681 | Open in IMG/M |
| 3300032770|Ga0335085_11764115 | Not Available | 635 | Open in IMG/M |
| 3300032805|Ga0335078_12207701 | Not Available | 580 | Open in IMG/M |
| 3300032898|Ga0335072_10678573 | Not Available | 1014 | Open in IMG/M |
| 3300032954|Ga0335083_10831981 | Not Available | 738 | Open in IMG/M |
| 3300033289|Ga0310914_10460707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1151 | Open in IMG/M |
| 3300034124|Ga0370483_0102729 | Not Available | 941 | Open in IMG/M |
| 3300034820|Ga0373959_0027657 | Not Available | 1128 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.97% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.97% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001647 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031955 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_11915270 | 2170459005 | Grass Soil | VPDWDNTESRESDEDAAWRDLVARFEEPTTTAGPV |
| JGI12635J15846_103226891 | 3300001593 | Forest Soil | VPDWDNTESRESDEDAAWRDLVARFAAPLTEQQPVPWPAREDMP |
| JGI20277J16323_1001311 | 3300001647 | Forest Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVP |
| Ga0070711_1004291912 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDWDNTESRESDEDATWRDLVARFETPTTTVGPVPWPDRENV |
| Ga0070730_108613122 | 3300005537 | Surface Soil | VPDWDNTESRERDEDAVWRDLVARYDAPLTAQEPVPWPDREEVA |
| Ga0070766_100692671 | 3300005921 | Soil | VPDWDNTDSRERDEDAAWRDLVARFDAPPITQQPVPWPERED |
| Ga0074050_111920331 | 3300006577 | Soil | VPDWDNTESRESDEDATWRDLVARFETPTTTAGPVPW |
| Ga0074057_123369461 | 3300006605 | Soil | VPDWDNTESRESDEDATWRDLVARFETPTTTAGPVPWPDRENVP |
| Ga0105237_127198961 | 3300009545 | Corn Rhizosphere | VPDWDNTESRESDEDATWRDLVARFETPTTTVGPV |
| Ga0126373_126251762 | 3300010048 | Tropical Forest Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWP |
| Ga0150983_165594101 | 3300011120 | Forest Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDMLAE |
| Ga0137364_103356233 | 3300012198 | Vadose Zone Soil | VPDWDNTESRESDEDAAWRDLVARFETPTTTAGPVPWP |
| Ga0137376_113833682 | 3300012208 | Vadose Zone Soil | VPDWDNTESRESDEDATWRDLVARFETPTTTAGPVPWPDREDVP |
| Ga0181531_102490511 | 3300014169 | Bog | VPDWDNTESRDRDEDAAWRDLIARFDAPPVTSQPVPWPAREDV |
| Ga0182030_102218914 | 3300014838 | Bog | VPDWDNTESRERDEDAVWRDLVARFDAPPITQQPVPWPEREDVLPP |
| Ga0182041_116765031 | 3300016294 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPTREDMPAEPAREPDGA |
| Ga0187812_11883281 | 3300017821 | Freshwater Sediment | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPA |
| Ga0187806_10677981 | 3300017928 | Freshwater Sediment | VPDWDNTDSRERDEDAAWRDLVARFDAPLAAQQPVPWPAREDM |
| Ga0187806_11230501 | 3300017928 | Freshwater Sediment | LPDWDNTDSRERDEDAAWRDLVARFDAPLAAQQPVPWPAREDM |
| Ga0187806_11580532 | 3300017928 | Freshwater Sediment | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPV |
| Ga0187817_101347801 | 3300017955 | Freshwater Sediment | VPDWDNTESREPDEDAAWRDLVARFDAPLTAQQPVPWPAREDMAPESTRETD |
| Ga0187817_103056951 | 3300017955 | Freshwater Sediment | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMAPESTRETD |
| Ga0187779_102378942 | 3300017959 | Tropical Peatland | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPW |
| Ga0187780_105165942 | 3300017973 | Tropical Peatland | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPACEDMAP |
| Ga0187884_102276871 | 3300018009 | Peatland | VPDWDNTDSRERDEDAAWRDLVARFDAPPITQQPVPWPEREDVLPPRPPE |
| Ga0187855_105148072 | 3300018038 | Peatland | VPDWDNTESRERDEDAAWRDLIARFDAPPITQQPVPW |
| Ga0187766_101402413 | 3300018058 | Tropical Peatland | VPDWDNTESRESDEDAAWRDLVARFEEPVTTTEPVPWPERENVPDPRPQARTDRIQRSDGTR |
| Ga0187772_114180351 | 3300018085 | Tropical Peatland | VPDWDNTESRESDEDAAWRDLVARFEEPATTTEPVPWPERENIPGQRPP |
| Ga0187769_103213361 | 3300018086 | Tropical Peatland | VADRDNTDSGESGEDAAWRDLVARYDAPLTAEEPVPWPEREGDAAAGASG |
| Ga0187771_106466561 | 3300018088 | Tropical Peatland | VPDWDDTERERDEDAAWRDLVARFDAPLTAQEPIPWPA |
| Ga0187770_106349342 | 3300018090 | Tropical Peatland | VADRDNTDSGESGEDAAWRDLVARYDAPLTAEEPVPWPEREGDAVTGASGV |
| Ga0181514_10484041 | 3300019268 | Peatland | VPDWDNTESRESDEDAAWRDLVARFAAPLTEQQPVPWPAREDMPAEPALEADG |
| Ga0210408_101765011 | 3300021178 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDK |
| Ga0213875_104675272 | 3300021388 | Plant Roots | MPDWDNAERRESDEDAAWRDLIARFDEPAPAAEPAPWPEREDV |
| Ga0210387_104692481 | 3300021405 | Soil | VPDWDNTESRESDEDAAWRDLVARFETPTTAAEPTP |
| Ga0210387_115145072 | 3300021405 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDMAAE |
| Ga0210383_110278262 | 3300021407 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAR |
| Ga0210410_102800483 | 3300021479 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDVPAEPAP |
| Ga0242656_11282191 | 3300022525 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAR |
| Ga0222756_10862842 | 3300022709 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDML |
| Ga0247667_10067624 | 3300024290 | Soil | VPDWDNTESRESDEDATWRDLVARFETPTTTVGPVPWPD |
| Ga0208589_11134101 | 3300025634 | Arctic Peat Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDMLA |
| Ga0207692_104728911 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDWDNTESRESDEDAAWRDLVARLEEPAAATGPVP |
| Ga0207680_112821712 | 3300025903 | Switchgrass Rhizosphere | VPDWDNTESRESDEDATWRDLVARFETPTTTVGPVP |
| Ga0208369_10059052 | 3300026998 | Forest Soil | VPDWDNTESRESDEDAAWRDLVARFEESTATTGPAPWPE |
| Ga0208237_10322791 | 3300027080 | Forest Soil | VPDWDNTESRESDEDAAWRDLVARFDAPLTGQEPVPWPAREDVLT |
| Ga0208241_10158293 | 3300027297 | Forest Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDMLAPPAP |
| Ga0209693_103136481 | 3300027855 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLIEQQPVPWPAR |
| Ga0209166_105735421 | 3300027857 | Surface Soil | VPDWDNTESRERDEDAVWRDLVARYDAPLTAQEPVPWPDREEVAGG |
| Ga0209579_101155051 | 3300027869 | Surface Soil | VPDWDNTESRERDEDAAWRDLVARYDAPLTAQEPVPWPDRED |
| Ga0209275_108784742 | 3300027884 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDVPAEPAPEA |
| Ga0209380_103560791 | 3300027889 | Soil | VPDWDNTDSRERDEDAAWRDLVARFDAPPITQQPVPWPEREDVL |
| Ga0268264_113464602 | 3300028381 | Switchgrass Rhizosphere | VPDWDNTESRESDEDATWRDLVARFETPTTTAGPVPWPDRENVPR |
| Ga0302219_102728241 | 3300028747 | Palsa | VPDWDNTESRESDEDAAWRDLVARFAAPLTEQQPVPWPAR |
| Ga0307290_102885752 | 3300028791 | Soil | VPDWDNTESRESDEDATWRDLVARFETPTTTAGPVPWPDR |
| Ga0302176_103747712 | 3300030057 | Palsa | VPDWDNTDSRERDEDAAWRDLVARFDAPPITQQPVPWPEREDLLP |
| Ga0311353_108004782 | 3300030399 | Palsa | VPDWDNTDSRERDEDAAWRDLVARFDAPPITQQPVPWPEREDVLP |
| Ga0311370_103360701 | 3300030503 | Palsa | VPDWDSTESRERDEDAAWRDLIARFDAPPITQQPVPWPER |
| Ga0311372_106876091 | 3300030520 | Palsa | VPDWDNTESRERDEDAAWRDLIARFDAPPNTQQPV |
| Ga0302325_127778242 | 3300031234 | Palsa | VPDWDNTESRESDEDAAWRDLVARFAAPLTGQQPVPWP |
| Ga0318534_100726123 | 3300031544 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTGQQPVPWPAREDMPAEPDG |
| Ga0318571_103755941 | 3300031549 | Soil | VADWDNTESGERDEDAAWRDLVARFDAPLTAQQPVPWPARE |
| Ga0318515_101068541 | 3300031572 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPPEPDGADAVRE |
| Ga0318515_104259022 | 3300031572 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPTATAGPVPWP |
| Ga0310915_111218542 | 3300031573 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPT |
| Ga0318561_101899501 | 3300031679 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPPEPDGADAVRES |
| Ga0318572_100349121 | 3300031681 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPQTAQQPVPWPAREDMPPEPDGAD |
| Ga0318560_106301991 | 3300031682 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMP |
| Ga0310686_1167269813 | 3300031708 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTEQQPVPWPAREDMAAEPAPEADGA |
| Ga0318501_103322081 | 3300031736 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPTREDMPAEPAR |
| Ga0318502_100934491 | 3300031747 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPTATAGPVPWPDREDM |
| Ga0318494_106131221 | 3300031751 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDTSPPPTRE |
| Ga0318535_101599022 | 3300031764 | Soil | VADWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPAREPDDTG |
| Ga0318535_105119012 | 3300031764 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEATTTAGPVPW |
| Ga0318554_103642392 | 3300031765 | Soil | VADWDNTESGERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPAREPD |
| Ga0318554_107120961 | 3300031765 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMSPPPTRETDG |
| Ga0318576_101154951 | 3300031796 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPPEPDGADGV |
| Ga0318497_105083611 | 3300031805 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMSPPLTRET |
| Ga0318567_103241273 | 3300031821 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPATTAGPVP |
| Ga0318527_103737892 | 3300031859 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMASEPALE |
| Ga0318495_102118611 | 3300031860 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPQTAQQPVPWPAREDMPPEPDCA |
| Ga0318544_102671572 | 3300031880 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMSPEPARETD |
| Ga0306923_114328661 | 3300031910 | Soil | VADWDNTESGERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPAREP |
| Ga0310913_109183801 | 3300031945 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPPREDM |
| Ga0306926_126782941 | 3300031954 | Soil | VADWDNTESRERDEDAAWRDLVARFDAPLTARQPVPWPAREDMPAREPDD |
| Ga0316035_1135141 | 3300031955 | Soil | VPDWDSTERSDSDEDAAWRDLIARFDSPVTAQEPVPWPEREDTSNAD |
| Ga0318558_103315442 | 3300032044 | Soil | LIRSGGDVPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVP |
| Ga0318513_101303863 | 3300032065 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPQTAQQPVP |
| Ga0308173_107660802 | 3300032074 | Soil | VPDWDNTESRESDEDAAWRELVARFEEPMATTEPVPWPERENVPGPQLPR |
| Ga0306924_117137211 | 3300032076 | Soil | VADWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPAREDMPA |
| Ga0306924_125502892 | 3300032076 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPTTTAGPVP |
| Ga0318518_103431941 | 3300032090 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPLTAQQPVPWPPREDMPPEPD |
| Ga0307472_1017776342 | 3300032205 | Hardwood Forest Soil | VPDWDNTESRESDEDAAWRDLVARFETPTTAAEPTPWPEREDVPRPR |
| Ga0306920_1022118771 | 3300032261 | Soil | VPDWDNTESRERDEDAAWRDLVARFDAPQTAQQPVPWPAREDMPPEPDC |
| Ga0348332_126888632 | 3300032515 | Plant Litter | VADRDNTDSGKSDEDTVWRDLVARYDVPLTAEEPAPWPEREGDPALGGAGISGVEVGR |
| Ga0335085_115755542 | 3300032770 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPVTTTEPAPWPERENVPG |
| Ga0335085_117641151 | 3300032770 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPATTTEPVPWPERE |
| Ga0335078_122077012 | 3300032805 | Soil | VPDWDNTDSRERDEDAAWRDLVARFDAPLAAQQPVPWPAREDMP |
| Ga0335072_106785731 | 3300032898 | Soil | VPDWDNTESRESDEDAAWRDLVARFEEPTTTARPVPWPDREDV |
| Ga0335083_108319812 | 3300032954 | Soil | VPDWDNTESRESDEDAAWRDLVARFEESATTAGPVPWPDREDVPRPYPVRGPD |
| Ga0310914_104607071 | 3300033289 | Soil | VADWDNTESGERDEDAAWRDLVARFDAPLTAQQPVPWPAREDM |
| Ga0370483_0102729_3_137 | 3300034124 | Untreated Peat Soil | MPDRDNTESRERDEDAAWRDLVARFDAPPITQQPVPWPEREDVLP |
| Ga0373959_0027657_1004_1126 | 3300034820 | Rhizosphere Soil | MPDWDNTESRESDEDATWRDLVARFETPTTTVGPVPWPDRE |
| ⦗Top⦘ |