| Basic Information | |
|---|---|
| Family ID | F099136 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MDVIATAIIVFFGTFSVAEKYLEPWVNDKVEQYYEAKE |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 78.64 % |
| % of genes near scaffold ends (potentially truncated) | 19.42 % |
| % of genes from short scaffolds (< 2000 bps) | 78.64 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (42.718 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.903 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.117 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 86.84% β-sheet: 0.00% Coil/Unstructured: 13.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF10544 | T5orf172 | 20.39 |
| PF02867 | Ribonuc_red_lgC | 6.80 |
| PF02945 | Endonuclease_7 | 6.80 |
| PF10276 | zf-CHCC | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 6.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.14 % |
| Unclassified | root | N/A | 37.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10004867 | Not Available | 7875 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10064708 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10108687 | Not Available | 996 | Open in IMG/M |
| 3300001965|GOS2243_1058513 | All Organisms → Viruses → Predicted Viral | 2601 | Open in IMG/M |
| 3300005057|Ga0068511_1098717 | Not Available | 520 | Open in IMG/M |
| 3300005522|Ga0066861_10223973 | Not Available | 643 | Open in IMG/M |
| 3300006027|Ga0075462_10142280 | Not Available | 735 | Open in IMG/M |
| 3300006735|Ga0098038_1046663 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300006735|Ga0098038_1060419 | All Organisms → Viruses → Predicted Viral | 1355 | Open in IMG/M |
| 3300006735|Ga0098038_1141557 | Not Available | 806 | Open in IMG/M |
| 3300006737|Ga0098037_1097165 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300006752|Ga0098048_1009714 | All Organisms → Viruses → Predicted Viral | 3447 | Open in IMG/M |
| 3300006789|Ga0098054_1171919 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 795 | Open in IMG/M |
| 3300006793|Ga0098055_1003825 | All Organisms → cellular organisms → Bacteria | 7538 | Open in IMG/M |
| 3300006793|Ga0098055_1003964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 7390 | Open in IMG/M |
| 3300006925|Ga0098050_1103502 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 727 | Open in IMG/M |
| 3300007544|Ga0102861_1152988 | Not Available | 627 | Open in IMG/M |
| 3300007863|Ga0105744_1096889 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 728 | Open in IMG/M |
| 3300007956|Ga0105741_1057677 | Not Available | 953 | Open in IMG/M |
| 3300007963|Ga0110931_1118216 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 797 | Open in IMG/M |
| 3300007992|Ga0105748_10067012 | All Organisms → Viruses → Predicted Viral | 1405 | Open in IMG/M |
| 3300009051|Ga0102864_1077198 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 906 | Open in IMG/M |
| 3300009056|Ga0102860_1077636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6 | 911 | Open in IMG/M |
| 3300009077|Ga0115552_1213761 | Not Available | 787 | Open in IMG/M |
| 3300009433|Ga0115545_1040821 | All Organisms → Viruses → Predicted Viral | 1823 | Open in IMG/M |
| 3300009550|Ga0115013_11528469 | Not Available | 501 | Open in IMG/M |
| 3300009593|Ga0115011_10192111 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300009593|Ga0115011_10317853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1188 | Open in IMG/M |
| 3300009593|Ga0115011_10558273 | Not Available | 917 | Open in IMG/M |
| 3300009790|Ga0115012_10304896 | Not Available | 1199 | Open in IMG/M |
| 3300010149|Ga0098049_1102498 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 895 | Open in IMG/M |
| 3300011258|Ga0151677_1072572 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300012919|Ga0160422_10077850 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300012919|Ga0160422_10190637 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300012919|Ga0160422_10532418 | Not Available | 741 | Open in IMG/M |
| 3300012920|Ga0160423_10040422 | All Organisms → Viruses → Predicted Viral | 3421 | Open in IMG/M |
| 3300012920|Ga0160423_10097176 | All Organisms → Viruses → Predicted Viral | 2085 | Open in IMG/M |
| 3300012920|Ga0160423_10209753 | All Organisms → Viruses → Predicted Viral | 1355 | Open in IMG/M |
| 3300012920|Ga0160423_10423085 | Not Available | 909 | Open in IMG/M |
| 3300012952|Ga0163180_10014046 | All Organisms → Viruses → Predicted Viral | 4517 | Open in IMG/M |
| 3300012952|Ga0163180_10663667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 801 | Open in IMG/M |
| 3300012953|Ga0163179_12241916 | Not Available | 505 | Open in IMG/M |
| 3300017708|Ga0181369_1051062 | Not Available | 925 | Open in IMG/M |
| 3300017713|Ga0181391_1058735 | Not Available | 898 | Open in IMG/M |
| 3300017714|Ga0181412_1011073 | All Organisms → Viruses → Predicted Viral | 2718 | Open in IMG/M |
| 3300017719|Ga0181390_1091808 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp. | 823 | Open in IMG/M |
| 3300017729|Ga0181396_1096877 | Not Available | 602 | Open in IMG/M |
| 3300017733|Ga0181426_1003980 | All Organisms → Viruses → Predicted Viral | 2888 | Open in IMG/M |
| 3300017738|Ga0181428_1161354 | Not Available | 524 | Open in IMG/M |
| 3300017744|Ga0181397_1042903 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300017746|Ga0181389_1165777 | Not Available | 582 | Open in IMG/M |
| 3300017752|Ga0181400_1026229 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300017758|Ga0181409_1023254 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
| 3300017772|Ga0181430_1052399 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300017783|Ga0181379_1059435 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300020247|Ga0211654_1015273 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300020258|Ga0211529_1071823 | Not Available | 588 | Open in IMG/M |
| 3300020299|Ga0211615_1051401 | Not Available | 626 | Open in IMG/M |
| 3300020305|Ga0211513_1041184 | Not Available | 705 | Open in IMG/M |
| 3300020306|Ga0211616_1019455 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300020362|Ga0211488_10214645 | Not Available | 514 | Open in IMG/M |
| 3300020379|Ga0211652_10068943 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300020401|Ga0211617_10003883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 7027 | Open in IMG/M |
| 3300020404|Ga0211659_10090420 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
| 3300020404|Ga0211659_10414260 | Not Available | 584 | Open in IMG/M |
| 3300020416|Ga0211644_10019639 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2758 | Open in IMG/M |
| 3300020430|Ga0211622_10444546 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 555 | Open in IMG/M |
| 3300020438|Ga0211576_10082221 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
| 3300020438|Ga0211576_10509664 | Not Available | 607 | Open in IMG/M |
| 3300020442|Ga0211559_10002687 | All Organisms → cellular organisms → Bacteria | 10066 | Open in IMG/M |
| 3300020442|Ga0211559_10032259 | All Organisms → Viruses → Predicted Viral | 2616 | Open in IMG/M |
| 3300020446|Ga0211574_10131368 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1096 | Open in IMG/M |
| 3300020459|Ga0211514_10275752 | Not Available | 828 | Open in IMG/M |
| 3300020463|Ga0211676_10006795 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 10333 | Open in IMG/M |
| 3300021335|Ga0213867_1218527 | Not Available | 627 | Open in IMG/M |
| 3300022046|Ga0224897_100116 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
| 3300022074|Ga0224906_1091556 | Not Available | 908 | Open in IMG/M |
| 3300022074|Ga0224906_1097281 | Not Available | 873 | Open in IMG/M |
| 3300022074|Ga0224906_1166190 | Not Available | 616 | Open in IMG/M |
| 3300023696|Ga0228687_1020655 | Not Available | 755 | Open in IMG/M |
| 3300024248|Ga0228676_1032607 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300024292|Ga0228630_1037626 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300024420|Ga0228632_1009571 | All Organisms → Viruses → Predicted Viral | 2177 | Open in IMG/M |
| 3300025101|Ga0208159_1015980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1896 | Open in IMG/M |
| 3300025101|Ga0208159_1036017 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300025102|Ga0208666_1092564 | Not Available | 758 | Open in IMG/M |
| 3300025108|Ga0208793_1041472 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300025128|Ga0208919_1056808 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300025632|Ga0209194_1029141 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300026258|Ga0208130_1024794 | All Organisms → Viruses → Predicted Viral | 2082 | Open in IMG/M |
| 3300026491|Ga0228641_1004426 | All Organisms → Viruses → Predicted Viral | 4103 | Open in IMG/M |
| 3300027077|Ga0208941_1035271 | Not Available | 660 | Open in IMG/M |
| 3300027213|Ga0208555_1070973 | Not Available | 530 | Open in IMG/M |
| 3300027859|Ga0209503_10075242 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300027906|Ga0209404_10000962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 20967 | Open in IMG/M |
| 3300027906|Ga0209404_10170194 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300028233|Ga0256417_1128106 | Not Available | 683 | Open in IMG/M |
| 3300029318|Ga0185543_1094208 | Not Available | 584 | Open in IMG/M |
| 3300029448|Ga0183755_1034190 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
| 3300031774|Ga0315331_10058124 | All Organisms → Viruses → Predicted Viral | 2867 | Open in IMG/M |
| 3300031775|Ga0315326_10815392 | Not Available | 580 | Open in IMG/M |
| 3300032011|Ga0315316_10040049 | All Organisms → Viruses → Predicted Viral | 3705 | Open in IMG/M |
| 3300032011|Ga0315316_10238335 | Not Available | 1522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.21% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 20.39% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 15.53% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.80% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.88% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.88% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 2.91% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.94% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020299 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016) | Environmental | Open in IMG/M |
| 3300020305 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX556024-ERR599003) | Environmental | Open in IMG/M |
| 3300020306 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX556014-ERR599098) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300022046 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023696 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026491 | Seawater microbial communities from Monterey Bay, California, United States - 52D | Environmental | Open in IMG/M |
| 3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100048679 | 3300000115 | Marine | MDVIVTAVIVFFGTFSIAEKYLEPWLEDKVEQYYEAKE* |
| DelMOSum2011_100647083 | 3300000115 | Marine | MEVVATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE* |
| DelMOWin2010_101086871 | 3300000117 | Marine | SRYNIGVIMEVVATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE* |
| GOS2243_10585132 | 3300001965 | Marine | MDVIVTALITFLGVHSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0068511_10987172 | 3300005057 | Marine Water | VNMDILATAVIVFFGTFSVAEKYLEPWVNDKVDQYYEAKE* |
| Ga0066861_102239733 | 3300005522 | Marine | MDVIATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE* |
| Ga0075462_101422802 | 3300006027 | Aqueous | MDVIATAIIVFFATFSVTEKYLEPWVNEKVDQYYEAKE* |
| Ga0098038_10466634 | 3300006735 | Marine | MEVVATAIIVFFATFSLTEKYLEPWVNDKVDQYYEAKE* |
| Ga0098038_10604192 | 3300006735 | Marine | MDVLATAIIVFFGTFSVAEKYIEPWVNNKVDSYYEAKE* |
| Ga0098038_11415571 | 3300006735 | Marine | MDVIVTAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0098037_10971654 | 3300006737 | Marine | MEVVATAIIVFFATFSVTEKYLEPWVNDKVNQYYEAKE* |
| Ga0098048_10097141 | 3300006752 | Marine | MEVVATAIIVFFATFSVTEKYLEPWLEDKVEQYYEAKE* |
| Ga0098054_11719191 | 3300006789 | Marine | MDVLATAIIVFFGTFSVAEKYIEPWVNNKVDSYYE |
| Ga0098055_10038258 | 3300006793 | Marine | MDVLATAIIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE* |
| Ga0098055_10039642 | 3300006793 | Marine | MEIAATAIIVFFATFSVTEKYLEPWLEDKVEQYYEAKE* |
| Ga0098050_11035022 | 3300006925 | Marine | MDVLATAIIVFFGTFSVAEKYLEPWLENKVEQYYEAKE* |
| Ga0102861_11529882 | 3300007544 | Estuarine | MEVVATAIIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE* |
| Ga0105744_10968892 | 3300007863 | Estuary Water | MEVVATAIIVFFGTFSVAEKYLEPWLEDKENSIMKQRSK* |
| Ga0105741_10576773 | 3300007956 | Estuary Water | MDVIVTAVIVFFGTFSIAEKYLEPWVNDKVNQYYEAKE* |
| Ga0110931_11182162 | 3300007963 | Marine | MEIAATAIIVFFATFSVTEKYLEPWLEDKVEQYYETKE* |
| Ga0105748_100670125 | 3300007992 | Estuary Water | MEIVATAIIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE* |
| Ga0102864_10771981 | 3300009051 | Estuarine | MEVIVSAVIAYFAVGAIAENYLEPWVNDKVEQYYEAKE* |
| Ga0102860_10776362 | 3300009056 | Estuarine | MDVIVTAVIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE* |
| Ga0115552_12137612 | 3300009077 | Pelagic Marine | MDVIVTAVIVFFGTFSIAEKYLEPWVNDKVDQYYEAKE* |
| Ga0115545_10408212 | 3300009433 | Pelagic Marine | MEVVATAIIVFFATFSVAEKYLEPWVNDKVEQYYEAKE* |
| Ga0115013_115284691 | 3300009550 | Marine | MDVIATAIIVFFGTFSVAEKYIEPWVNNKVDQYYEVKE* |
| Ga0115011_101921112 | 3300009593 | Marine | MDVLATVVIVFFGTFSVAEKYIEPWVNNKVDQYYEAKE* |
| Ga0115011_103178532 | 3300009593 | Marine | MDVLATAIIVFFGTFSVAEKYLEPWVNDKVEQYYEAKE* |
| Ga0115011_105582733 | 3300009593 | Marine | MDVIVTALITFIGVHSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0115012_103048964 | 3300009790 | Marine | NMDVIVTAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0098049_11024982 | 3300010149 | Marine | MEVVATAIIVFFATFSVTEKYLEPWVNDKVDQYYEAKE* |
| Ga0151677_10725722 | 3300011258 | Marine | MEVVATAIIVFFATFSITEKYLEPWVNDKVEQYYEAKE* |
| Ga0160422_100778504 | 3300012919 | Seawater | MDVIATAIIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0160422_101906371 | 3300012919 | Seawater | MDVIATAIIVFFATFSVTEKYLEPWVNDKVEQYYETKE* |
| Ga0160422_105324181 | 3300012919 | Seawater | MDVIVTALITFRGVHSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0160423_100404223 | 3300012920 | Surface Seawater | MDVLATAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0160423_100971761 | 3300012920 | Surface Seawater | SSRHNIGVNMDILATAVIVFFGTFSVAEKYLEPWVNDKVDQYYEAKE* |
| Ga0160423_102097533 | 3300012920 | Surface Seawater | MDILATAVIVFFGTFSVAEKYLEPWVNDKVDQYYEAKE* |
| Ga0160423_104230853 | 3300012920 | Surface Seawater | MDVIATAVIVFFATFSITEKYLEPWVNDKVEQYYEEKE* |
| Ga0163180_100140461 | 3300012952 | Seawater | MDVLATAVIVFFGTFSVAEKYIEPWVNDKVEQYYEAKE* |
| Ga0163180_106636672 | 3300012952 | Seawater | MDVLATAVIVFFGTFSVAEKYIEPWVNDKVEQHYEAKD* |
| Ga0163179_122419163 | 3300012953 | Seawater | DMDVIVTAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE* |
| Ga0181369_10510623 | 3300017708 | Marine | MDVLATAIIVFFGTFSVAEKYIEPWVNDKVDSYYEAKE |
| Ga0181391_10587354 | 3300017713 | Seawater | VIMEVIVSAVIAYFAVGAIAEKYLEPWVNDKVEQYYEAKE |
| Ga0181412_10110731 | 3300017714 | Seawater | IVSAVIAYFAVGAIAEKYLEPWVNDKVEQYYEAKE |
| Ga0181390_10918082 | 3300017719 | Seawater | MEVVATAIIVFFATFSVTEKYLEPWVNDKVNQYYEAKE |
| Ga0181396_10968771 | 3300017729 | Seawater | VATAIIVFFATFSLTEKYLEPWVNDKVDQYYEAKE |
| Ga0181426_10039805 | 3300017733 | Seawater | MEVVATAIIVFFATFSVTEKYLEPWVNDKVEQYYETKE |
| Ga0181428_11613541 | 3300017738 | Seawater | MDVIVTAVIVFFGTFSIAEKNLEPWVNDKVEQYYEAKE |
| Ga0181397_10429031 | 3300017744 | Seawater | NMEVVATAIIVFFATFSVTEKYLEPWVNDKVNQYYEAKE |
| Ga0181389_11657773 | 3300017746 | Seawater | MEVIVSAVIAYFAVGAIAEKYLEPWVNDKVDQYYEAKE |
| Ga0181400_10262291 | 3300017752 | Seawater | MEVVATAIIVFFATFSVAEKYLEPWLEDKVEQYYEAKE |
| Ga0181409_10232544 | 3300017758 | Seawater | SRYNIGVIMEVVATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0181430_10523992 | 3300017772 | Seawater | MEVIVSAVIAYFAVGSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0181379_10594351 | 3300017783 | Seawater | MEVVATAIIVFFGTFSVAEKYLEPWVNDKVNQYYEAKE |
| Ga0211654_10152732 | 3300020247 | Marine | MDVLATVVIVFFGTFSVAEKYIEPWVNDKVDQYYEAKE |
| Ga0211529_10718231 | 3300020258 | Marine | MDVIATAIIVFFATFSVTEKYLEPWVNEKVDQYYEAKE |
| Ga0211615_10514013 | 3300020299 | Marine | MDAIATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0211513_10411842 | 3300020305 | Marine | MEVVATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0211616_10194553 | 3300020306 | Marine | MDVIATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0211488_102146453 | 3300020362 | Marine | MDIIATAVIVFFATFSITEKYLEPWVNDKVDQYYEAKE |
| Ga0211652_100689433 | 3300020379 | Marine | MDILATAVIVFFGTFSVAEKYLEPWVNDKVDQYYEAKE |
| Ga0211617_100038837 | 3300020401 | Marine | MDVLATAVIVFFGAFSVAEKYIEPWVNDKVEQHYEAKE |
| Ga0211659_100904202 | 3300020404 | Marine | MEVIVTALITFLGVHSIAEKYVEPWVNDKVEQYYEAKE |
| Ga0211659_104142603 | 3300020404 | Marine | MEVVATAIIVFFATFSLTEKYLEPWVNDKVNQYYEAKE |
| Ga0211644_100196394 | 3300020416 | Marine | MDVLATAVIVFFGTFSVAEKYIEPWVNDKVEQYYEAKE |
| Ga0211622_104445461 | 3300020430 | Marine | NMDVIATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0211576_100822212 | 3300020438 | Marine | MEVVATAIIVFFGTFSVAEKYLEPWLEDKVQQYYEAKE |
| Ga0211576_105096642 | 3300020438 | Marine | MEVVATAIIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE |
| Ga0211559_1000268711 | 3300020442 | Marine | MDVIATAVIVFFATFSITEKYLEPWVNDKVEQYYEKKE |
| Ga0211559_100322594 | 3300020442 | Marine | MDVIVTAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0211574_101313681 | 3300020446 | Marine | VIATAIIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0211514_102757522 | 3300020459 | Marine | MDVIATAIIVFFGTFSVAEKYIEPWVNNKVDQYYEVKE |
| Ga0211676_1000679510 | 3300020463 | Marine | MDVIVTALITFLGVHSIAEKYVEPWVNDKVEQYYEAKE |
| Ga0213867_12185272 | 3300021335 | Seawater | MDVLVTAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0224897_1001162 | 3300022046 | Seawater | MEVIVSAVIAYFAVGAIAEKYLEPWVNDKVEQYYEAKE |
| Ga0224906_10915562 | 3300022074 | Seawater | MEVVATAIIVFFATFSLTEKYLEPWVNDKVDQYYEAKE |
| Ga0224906_10972812 | 3300022074 | Seawater | MEVIVSAVIAYFAVGTIAEKYLEPWVNDKVEQYYEAKE |
| Ga0224906_11661901 | 3300022074 | Seawater | IGVIMEVIVSAVIAYFAVGSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0228687_10206553 | 3300023696 | Seawater | MEVVATAIIVFFATFSVTEKYLEPWVNDKVDQYYQAKE |
| Ga0228676_10326071 | 3300024248 | Seawater | EVVATAIIVFFATFSVTEKYLEPWVNNKVEQYYEAKE |
| Ga0228630_10376262 | 3300024292 | Seawater | MEVVATAIIVFFATFSVTEKYLEPWVNDKVDQYYQ |
| Ga0228632_10095712 | 3300024420 | Seawater | MEVIVSAVIAYFAVGSIAEKYLEPWVNDKLEQYYEAKE |
| Ga0208159_10159801 | 3300025101 | Marine | MDVIVTALITFLGVHSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0208159_10360172 | 3300025101 | Marine | MDVLATAIIVFFGTFSVAEKYIEPWVNNKVDSYYEAKE |
| Ga0208666_10925642 | 3300025102 | Marine | MEVVATAIIVFFATFSVTEKYLEPWVNDKVDQYYEAKE |
| Ga0208793_10414723 | 3300025108 | Marine | MDVLATAIIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE |
| Ga0208919_10568082 | 3300025128 | Marine | MEVVATAIIVFFATFSVTEKYLEPWLEDKVEQYYETKE |
| Ga0209194_10291412 | 3300025632 | Pelagic Marine | MDVIVTAVIVFFGTFSIAEKYLEPWLEDKVEQYYEAKE |
| Ga0208130_10247942 | 3300026258 | Marine | MDVIATAVIVFFATFSITEKYLEPWVNEKVDQYYEAKE |
| Ga0228641_10044262 | 3300026491 | Seawater | MEVVATAIIVFFATFSVTEKYLEPWVNNKVEQYYEAKE |
| Ga0208941_10352712 | 3300027077 | Marine | MEVVATAIIVFFATFSLTEKYLEPWVNDKVDQYYEAK |
| Ga0208555_10709733 | 3300027213 | Estuarine | MDVIVTAVIVFFGTFSVAEKYLEPWLEDKVEQYYEAKE |
| Ga0209503_100752422 | 3300027859 | Marine | MDVIVTALIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0209404_1000096220 | 3300027906 | Marine | MDVLATAIIVFFGTFSVAEKYLEPWVNDKVEQYYEVKE |
| Ga0209404_101701942 | 3300027906 | Marine | MDVLATVVIVFFGTFSVAEKYIEPWVNNKVDQYYEAKE |
| Ga0256417_11281062 | 3300028233 | Seawater | MEVVATAIIVFFATFSLTEKYLEPWLEDKVEQYYETKE |
| Ga0185543_10942081 | 3300029318 | Marine | VIATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0183755_10341901 | 3300029448 | Marine | MEVVATAIIVFFATFSVTEKYLEPWVNDKVEQYYEA |
| Ga0315331_100581244 | 3300031774 | Seawater | MDVIATAIIVFFGTFSVAEKYLEPWVNDKVEQYYEAKE |
| Ga0315326_108153923 | 3300031775 | Seawater | VATAIIVFFATFSVTEKYLEPWVNDKVEQYYEAKE |
| Ga0315316_100400497 | 3300032011 | Seawater | MDVIVTAVRVFFGTFSIAEKYLEPWVNDKVEQYYEAKE |
| Ga0315316_102383355 | 3300032011 | Seawater | IVTAVIVFFGTFSIAEKYLEPWVNDKVEQYYEAKE |
| ⦗Top⦘ |