Basic Information | |
---|---|
Family ID | F099090 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | MHTVLGLLAFIVFIAAVIGVAAGITWVVVRVSPAKKPDATPKT |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.79 % |
% of genes near scaffold ends (potentially truncated) | 14.56 % |
% of genes from short scaffolds (< 2000 bps) | 76.70 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.078 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (14.563 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.388 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.340 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF01262 | AlaDh_PNT_C | 39.81 |
PF05222 | AlaDh_PNT_N | 9.71 |
PF01676 | Metalloenzyme | 7.77 |
PF01546 | Peptidase_M20 | 4.85 |
PF00293 | NUDIX | 2.91 |
PF02885 | Glycos_trans_3N | 0.97 |
PF00117 | GATase | 0.97 |
PF01728 | FtsJ | 0.97 |
PF07687 | M20_dimer | 0.97 |
PF01149 | Fapy_DNA_glyco | 0.97 |
PF13508 | Acetyltransf_7 | 0.97 |
PF07831 | PYNP_C | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG0213 | Thymidine phosphorylase | Nucleotide transport and metabolism [F] | 0.97 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.97 |
COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.97 |
COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.08 % |
Unclassified | root | N/A | 35.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ61VE201BYYHZ | Not Available | 530 | Open in IMG/M |
2170459019|G14TP7Y02HS942 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
2189573001|GZR05M101AMN2B | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 503 | Open in IMG/M |
3300004479|Ga0062595_100415387 | Not Available | 971 | Open in IMG/M |
3300005167|Ga0066672_10779622 | Not Available | 604 | Open in IMG/M |
3300005171|Ga0066677_10168497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1210 | Open in IMG/M |
3300005171|Ga0066677_10339673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 860 | Open in IMG/M |
3300005177|Ga0066690_10172495 | Not Available | 1431 | Open in IMG/M |
3300005186|Ga0066676_11029459 | Not Available | 546 | Open in IMG/M |
3300005434|Ga0070709_10912700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 695 | Open in IMG/M |
3300005436|Ga0070713_100043207 | All Organisms → cellular organisms → Bacteria | 3683 | Open in IMG/M |
3300005439|Ga0070711_100943923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 738 | Open in IMG/M |
3300005445|Ga0070708_101775672 | Not Available | 573 | Open in IMG/M |
3300005454|Ga0066687_10009126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3752 | Open in IMG/M |
3300005468|Ga0070707_100541023 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300005471|Ga0070698_100216629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1849 | Open in IMG/M |
3300005471|Ga0070698_100429758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1255 | Open in IMG/M |
3300005529|Ga0070741_10450148 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300005529|Ga0070741_10706907 | Not Available | 888 | Open in IMG/M |
3300005529|Ga0070741_11374805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 588 | Open in IMG/M |
3300005530|Ga0070679_101645905 | Not Available | 590 | Open in IMG/M |
3300005533|Ga0070734_10149243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1357 | Open in IMG/M |
3300005534|Ga0070735_10157916 | Not Available | 1404 | Open in IMG/M |
3300005534|Ga0070735_10550527 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005538|Ga0070731_10340240 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005538|Ga0070731_10397031 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300005542|Ga0070732_10002976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9127 | Open in IMG/M |
3300005575|Ga0066702_10028502 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300005575|Ga0066702_10833492 | Not Available | 549 | Open in IMG/M |
3300006034|Ga0066656_10538276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300006046|Ga0066652_101533456 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300006755|Ga0079222_11227110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 675 | Open in IMG/M |
3300006796|Ga0066665_11689524 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300006800|Ga0066660_10209559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1494 | Open in IMG/M |
3300006800|Ga0066660_11394101 | Not Available | 549 | Open in IMG/M |
3300006806|Ga0079220_10605614 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300006903|Ga0075426_10931377 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300009093|Ga0105240_11236749 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300009137|Ga0066709_103777204 | Not Available | 550 | Open in IMG/M |
3300009629|Ga0116119_1060702 | Not Available | 969 | Open in IMG/M |
3300010140|Ga0127456_1017922 | Not Available | 541 | Open in IMG/M |
3300010323|Ga0134086_10174342 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300010360|Ga0126372_11528949 | Not Available | 704 | Open in IMG/M |
3300010373|Ga0134128_11459883 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300010379|Ga0136449_100423243 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
3300010398|Ga0126383_12141588 | Not Available | 646 | Open in IMG/M |
3300010866|Ga0126344_1168341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2092 | Open in IMG/M |
3300010880|Ga0126350_10154554 | Not Available | 550 | Open in IMG/M |
3300010880|Ga0126350_12264539 | Not Available | 574 | Open in IMG/M |
3300012204|Ga0137374_10197491 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
3300012212|Ga0150985_101342280 | Not Available | 530 | Open in IMG/M |
3300012350|Ga0137372_10036758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4445 | Open in IMG/M |
3300012923|Ga0137359_10074659 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
3300015356|Ga0134073_10084893 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300017927|Ga0187824_10119946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 856 | Open in IMG/M |
3300017930|Ga0187825_10237415 | Not Available | 665 | Open in IMG/M |
3300017940|Ga0187853_10226573 | Not Available | 866 | Open in IMG/M |
3300017961|Ga0187778_10023776 | All Organisms → cellular organisms → Bacteria | 3746 | Open in IMG/M |
3300017966|Ga0187776_10634935 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300018060|Ga0187765_10136559 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300018060|Ga0187765_11315650 | Not Available | 512 | Open in IMG/M |
3300018089|Ga0187774_11097852 | Not Available | 563 | Open in IMG/M |
3300018468|Ga0066662_10201701 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
3300019888|Ga0193751_1002737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10607 | Open in IMG/M |
3300021170|Ga0210400_10851793 | Not Available | 746 | Open in IMG/M |
3300021444|Ga0213878_10253761 | Not Available | 748 | Open in IMG/M |
3300025548|Ga0208716_1050828 | Not Available | 881 | Open in IMG/M |
3300025812|Ga0208457_1023722 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
3300025910|Ga0207684_11160432 | Not Available | 641 | Open in IMG/M |
3300025922|Ga0207646_10070567 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
3300026322|Ga0209687_1266740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 534 | Open in IMG/M |
3300026324|Ga0209470_1281148 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300026527|Ga0209059_1040058 | Not Available | 2091 | Open in IMG/M |
3300027655|Ga0209388_1226452 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300027826|Ga0209060_10312195 | Not Available | 717 | Open in IMG/M |
3300027842|Ga0209580_10057529 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
3300027869|Ga0209579_10008509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 6486 | Open in IMG/M |
3300027869|Ga0209579_10039811 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
3300027869|Ga0209579_10740274 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300027905|Ga0209415_10640729 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300027986|Ga0209168_10115283 | Not Available | 1379 | Open in IMG/M |
3300028563|Ga0265319_1002767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9404 | Open in IMG/M |
3300028800|Ga0265338_10034800 | All Organisms → cellular organisms → Bacteria | 4857 | Open in IMG/M |
3300031670|Ga0307374_10002585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 31918 | Open in IMG/M |
3300031715|Ga0307476_10048297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2893 | Open in IMG/M |
3300031715|Ga0307476_11219983 | Not Available | 550 | Open in IMG/M |
3300031753|Ga0307477_10032525 | All Organisms → cellular organisms → Bacteria | 3571 | Open in IMG/M |
3300031754|Ga0307475_10353000 | Not Available | 1181 | Open in IMG/M |
3300031754|Ga0307475_10546695 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300031962|Ga0307479_11162959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 736 | Open in IMG/M |
3300031962|Ga0307479_12073962 | Not Available | 517 | Open in IMG/M |
3300032008|Ga0318562_10570732 | Not Available | 654 | Open in IMG/M |
3300032133|Ga0316583_10060213 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300032205|Ga0307472_102409087 | Not Available | 534 | Open in IMG/M |
3300032783|Ga0335079_10369535 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300032828|Ga0335080_10988115 | Not Available | 858 | Open in IMG/M |
3300032829|Ga0335070_10030969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6084 | Open in IMG/M |
3300032892|Ga0335081_10112358 | All Organisms → cellular organisms → Bacteria | 4012 | Open in IMG/M |
3300032892|Ga0335081_10192940 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
3300032892|Ga0335081_10891981 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300033233|Ga0334722_10094075 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
3300033806|Ga0314865_083447 | Not Available | 833 | Open in IMG/M |
3300033808|Ga0314867_008440 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 14.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.91% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.94% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.97% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.97% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.97% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300025548 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_00381300 | 2170459007 | Grass Soil | LVVSTVLGLIAFVVFIACIVGLAAGITWVVVRFTPTKKKPDPAPKT |
4MG_04998600 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MATALGLLAFVLYIAAVVAAAAGITWLVVRFSPSKKPDAESKT |
FD2_07285230 | 2189573001 | Grass Soil | LVVSTVLGLIAFVVFIACIVGLAAGITWVVVHFTPTKKKPDPAPKT |
Ga0062595_1004153871 | 3300004479 | Soil | MHTVLGLAAFVVFIAAVISVAAGITWVVVRVSPAKKPDAAPKS* |
Ga0066672_107796221 | 3300005167 | Soil | MHTVLGLAAFIVFIAAVISVAAGITWVVVRVSPAKKPDATP |
Ga0066677_101684972 | 3300005171 | Soil | MHTVLGLLAFIVFIAAVVGVAAGITWVVVRVSPAKKPDAAPKS* |
Ga0066677_103396731 | 3300005171 | Soil | LTTVLGLLAFVVFIVAIIATAAGVTWLVVRLSPPKKPDAAPNKS* |
Ga0066690_101724953 | 3300005177 | Soil | MHTVLGLLAFIVFIAAVIGVAAGITWVVVRVSPAKKPDATPKT* |
Ga0066676_110294592 | 3300005186 | Soil | MTTALGLLAFVVFIAFVVGTAAGVTWLVVRLSPSKKPSAESKT* |
Ga0070709_109127002 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTALGLLAFVVFIVAIIAVAAGVTWVVVRFSPSKKPDAPPPAA* |
Ga0070713_1000432075 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTVLGLAAFVVFIAAVISVAAGVTWVVVRVSPAKKPDAAPKS* |
Ga0070711_1009439231 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLLAFVVFIVAIIAVAAGVTWVVVRFSPSKKPDAPPPAA* |
Ga0070708_1017756722 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLGLIAFVVFIACVIAAAAGITWVVVRFSPAKKPEPTPKT* |
Ga0066687_100091264 | 3300005454 | Soil | LTTVLGLLAFVVFIVAIIGTAAGVTWLVVRLSPPKKPDAAPNKS* |
Ga0070707_1005410232 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLGLIAFVVFIACVVAAAAGITWVVVRFSPSKKPETTPKS* |
Ga0070698_1002166291 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SGYSRFAVSTVLGLIAFVVFIACVIAAAAGITWVVVRFSPAKKPETTPKT* |
Ga0070698_1004297581 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLGLIAFAVFIACVIAAAAGITWVVVRFSPAKKPETTPKT* |
Ga0070741_104501482 | 3300005529 | Surface Soil | MQNVLGLIEFAVFIVAIVAFAAGITWVVVRFSPSKKPDSPTA* |
Ga0070741_107069071 | 3300005529 | Surface Soil | MHTVLGLLAFIVFIAAVISVAAGITWVVVRVSPAKKPDAA |
Ga0070741_113748052 | 3300005529 | Surface Soil | MHTALGLLAFIVFIAAVIGVAAGITWVVVRVSPAKKPDATPKT* |
Ga0070679_1016459052 | 3300005530 | Corn Rhizosphere | VSNVLGLLGFLVYIAAIVGAAAGITWVVVRFSPTKKPPAES* |
Ga0070734_101492432 | 3300005533 | Surface Soil | MTTALGLLAFVGYILAVVAVAAGVTWVVVRLTPTKKPDAAPKS* |
Ga0070735_101579162 | 3300005534 | Surface Soil | MHNALGLLAFVVYIAAIVGVAAGITWVVVRLSPPKKADESKPA* |
Ga0070735_105505272 | 3300005534 | Surface Soil | MHDALGLLFFVIFCASIIGAAAGITWVVVRLAPPKKADPAPKT* |
Ga0070731_103402402 | 3300005538 | Surface Soil | VSNVLGLLAFVVFIAAIIGLAAGITWVVVRFSPKKKPSPPAPNA* |
Ga0070731_103970312 | 3300005538 | Surface Soil | MSTVLGLLAFVLFIVAVIGVAAGITWLVVRLFPIKKPDAAPKA* |
Ga0070732_100029767 | 3300005542 | Surface Soil | MSAVLGLLAFVLFIVAIIGAAAGITWVVVRLSPPQQKPGATPKA* |
Ga0066702_100285022 | 3300005575 | Soil | MHTVLGLAAFIVFIAAVISVAAGITWVVVRVSPAKKPDATPKT* |
Ga0066702_108334922 | 3300005575 | Soil | MHTVLGLLAFVVYIAAIVGAAAGITWVVVRLSPPKKADESKPA* |
Ga0066656_105382762 | 3300006034 | Soil | MHTVLGLIGFVLFIAAIVGAAAGITWVVVRLSPPKKADESKPA* |
Ga0066652_1015334562 | 3300006046 | Soil | MDTVLGLVVFVVYIALVISFAAGVTWVVVRFTPTKKPKTETPAEG* |
Ga0079222_112271102 | 3300006755 | Agricultural Soil | MHTVLGLAAFVVFIAAVISVAAGITWIVVRVSPAKKPDAAPKS* |
Ga0066665_116895242 | 3300006796 | Soil | MNTVLGLLAFVVFIAAVIAAAAGITWVVVRLSPAKKPDEAAKT* |
Ga0066660_102095592 | 3300006800 | Soil | MHTVLGLAAFIVFIAAVISVAAGITWVVVRVSPAKKPDATPET* |
Ga0066660_113941012 | 3300006800 | Soil | MHTVLGLIGFVLFIVAIVGAAAGITWVVVRLSPPKKADESKPA* |
Ga0079220_106056142 | 3300006806 | Agricultural Soil | VAWSYSRFAMHTVLGLAAFVVFIAAVISVAAGITWIVVRVSPAKKPDAAPKS* |
Ga0075426_109313772 | 3300006903 | Populus Rhizosphere | MSTVLGLLAFVVFIVAIIAVAAGVTWVVVRFSPSKKPDAPPPAA* |
Ga0105240_112367492 | 3300009093 | Corn Rhizosphere | MHTVLGLAAFVVFIAAVISVAAGITWVVVRVSPAKKPDATPKA* |
Ga0066709_1037772041 | 3300009137 | Grasslands Soil | TVLGLIAFVVFIAFVVAIAAGITWLVVRVSPAKKPDAAPKT* |
Ga0116119_10607021 | 3300009629 | Peatland | IAFVVFIAAVIAVAAAVTWVVVRLSPAKKSGPAKPSS* |
Ga0127456_10179221 | 3300010140 | Grasslands Soil | VLGLLAFIVFIAAVVGVAAGITWVVVRVSPAKKPDAAPKS* |
Ga0134086_101743422 | 3300010323 | Grasslands Soil | MTTALGLLAFVVFIAFVVGTAAGVTWLVVRLSPSKKPSAEGKT* |
Ga0126372_115289492 | 3300010360 | Tropical Forest Soil | MSNVLGLLLFVVFIAAVIGAAAAITWVVVRLSPLKGPQPEPPKT* |
Ga0134128_114598832 | 3300010373 | Terrestrial Soil | MNSVLGLLAFVLFCACVVGAAAGITWVVVRLSPPKKPDAAPKT* |
Ga0136449_1004232433 | 3300010379 | Peatlands Soil | MTTVLGLLAFVLFIACIIGAAAGITWVVVKVSPPKRPDAQPKGDG* |
Ga0126383_121415882 | 3300010398 | Tropical Forest Soil | MATFLGLLAFALYIILIISFAAAVTWVVVRFSPAKKPDAAPKT* |
Ga0126344_11683411 | 3300010866 | Boreal Forest Soil | MHTALGLVGFVVFIASVIGVAAGITWLVVRLAPPKKPDATPKT* |
Ga0126350_101545542 | 3300010880 | Boreal Forest Soil | MHTALGLVGFVVFIASVIGVAAGITWLVVRLVPPKKPDATPKT* |
Ga0126350_122645392 | 3300010880 | Boreal Forest Soil | VATGLGLVGVVVFIATVVALAAGITWLVVRLAPPKKPDATPKA* |
Ga0137374_101974913 | 3300012204 | Vadose Zone Soil | MSSVLGLVAFVVFIAAVVAAAAGITWVVVRVSPAKAPDQAPKT* |
Ga0150985_1013422802 | 3300012212 | Avena Fatua Rhizosphere | CSSDLNVLGLLAFVVFIAAIIALAAGITWSVVRLSPPKKQAPPADSA* |
Ga0137372_100367582 | 3300012350 | Vadose Zone Soil | MSTVLGLVAFVVFIAAVVAAAAGITWVVVRVSPAKAPDQAPKT* |
Ga0137359_100746592 | 3300012923 | Vadose Zone Soil | VSSVLGLIAFVVFIAAVIAAAAGITWLVVRISPAKKKPEAAKQE* |
Ga0134073_100848932 | 3300015356 | Grasslands Soil | MHTVLGLLAFVVFIAAVISAAAAITWLVVRLSPAKKPDAAPKS* |
Ga0187824_101199462 | 3300017927 | Freshwater Sediment | MQNVLGLIEFAVFIAAIVAFAAGITWVVVRFSPSKKPDAPTT |
Ga0187825_102374152 | 3300017930 | Freshwater Sediment | MQSALGLIEFAVFIAAIVSLAAGITWVVVRVSPAKKPNAPSA |
Ga0187853_102265731 | 3300017940 | Peatland | AFVAFIAVVITVAAAVTWLVVRLSPAKKPDAAKPS |
Ga0187778_100237762 | 3300017961 | Tropical Peatland | MTTVLGLLAFVVFIACVIATAAGITWIVVRFSPAKKPKASAP |
Ga0187776_106349352 | 3300017966 | Tropical Peatland | MTTALGLLAFLVFIAVVIATAAGVTWVVVRLSPAKKTKASTGS |
Ga0187765_101365592 | 3300018060 | Tropical Peatland | VSTALGLIAFVVFIVVVIATAAGVTWVVVRFSPAKKPKASAPS |
Ga0187765_113156502 | 3300018060 | Tropical Peatland | IGFALFIVCVIAAAAGITWLVVRLSPGKKPGAAPAPPKA |
Ga0187774_110978522 | 3300018089 | Tropical Peatland | VTTALGLIAFVFFIVVVIATAAGVTWVVVRFSPAKKPKASAPS |
Ga0066662_102017012 | 3300018468 | Grasslands Soil | MHTVLGLAAFIVFIAAVISVAAGITWVVVRVSPAKKPDATPET |
Ga0193751_100273712 | 3300019888 | Soil | MHTALGLVGFVVFIASVIGVAAGITWLVVRLAPPKKPDATPKT |
Ga0210400_108517932 | 3300021170 | Soil | VSTVLGLIAFVVFIACIVAAAAGITWVVVRFSPTKKPDAAPKT |
Ga0213878_102537612 | 3300021444 | Bulk Soil | TVLGLLAFVVFIAAIIGLAAALTWVVVRFSPSKKPDATAPKS |
Ga0208716_10508282 | 3300025548 | Arctic Peat Soil | MTTALGLLAFVVFIVAVIATAASVTWLVVRFSPAKKKPGAAPTP |
Ga0208457_10237221 | 3300025812 | Peatland | MTTALGLIAFVVFIAAVIAVAAAVTWVVVRLSPAKKSGPAK |
Ga0207684_111604322 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLGLIAFVVFIACVIAAAAGITWVVVRFSPAKKPEPTPKT |
Ga0207646_100705672 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTVLGLIAFVVFIACVVAAAAGITWVVVRFSPSKKPETTPKS |
Ga0209687_12667402 | 3300026322 | Soil | MHTVLGLLAFIVFIAAVVGVAAGITWVVVRVSPAKKPDAAPKS |
Ga0209470_12811482 | 3300026324 | Soil | MTTALGLLAFVVFIAFVVGTAAGVTWLVVRLSPSKKPSAESKT |
Ga0209059_10400583 | 3300026527 | Soil | MHTVLGLAAFIVFIAAVISVAAGITWVVVRVSPAKKPDATPKT |
Ga0209388_12264521 | 3300027655 | Vadose Zone Soil | LGFVVYIAAIIAAAAGVTWIVVRLSPAKKPDTTPPG |
Ga0209060_103121952 | 3300027826 | Surface Soil | MTTALGLLAFVGYILAVVAVAAGVTWVVVRLTPTKKPDAAPKS |
Ga0209580_100575292 | 3300027842 | Surface Soil | MSAVLGLLAFVLFIVAIIGAAAGITWVVVRLSPPQQKPGATPKA |
Ga0209579_100085097 | 3300027869 | Surface Soil | VSNVLGLLAFVVFIAAIIGLAAGITWVVVRFSPKKKPSPPAPNA |
Ga0209579_100398111 | 3300027869 | Surface Soil | MSTVLGLLAFVLFIVAVIGVAAGITWLVVRLFPIKKPDAAPKA |
Ga0209579_107402742 | 3300027869 | Surface Soil | MQDVLGLVFFVLFCSAVIGAAAGITWVVVRLAPPKKPDPAPKT |
Ga0209415_106407292 | 3300027905 | Peatlands Soil | MTTVLGLLAFVLFIACIIGAAAGITWVVVKVSPPKRPDAQPKGDG |
Ga0209168_101152832 | 3300027986 | Surface Soil | MHNALGLLAFVVYIAAIVGVAAGITWVVVRLSPPKKADESKPA |
Ga0265319_10027672 | 3300028563 | Rhizosphere | MTTALGLLAFIFFIVAVIATAAGITWVVVRFTPKKKPAAAKTES |
Ga0265338_100348003 | 3300028800 | Rhizosphere | MSSALGLLAFALYILAIIAAAAGITWVVVRFSPSKKPDAAEKS |
Ga0307374_100025857 | 3300031670 | Soil | MHTALGLVGFVVFIAAVIGVAAGITWLVVRLAPPKKPDATPKA |
Ga0307476_100482972 | 3300031715 | Hardwood Forest Soil | MQDAIGLVFFVLFCCAVIGAAAGITWVVVRLAPPKKPDPAPKT |
Ga0307476_112199831 | 3300031715 | Hardwood Forest Soil | AFVLFIVAVIGVAAGITWLVVRLFPIKKPDAAPKG |
Ga0307477_100325252 | 3300031753 | Hardwood Forest Soil | MSAVLGLLAFVLFIVAIIGAAAGITWVVVRLSPPQQKPDATPKA |
Ga0307475_103530001 | 3300031754 | Hardwood Forest Soil | MSTVLGLLAFLVFIVAIVGVAAGITWVVVRLSPSKKPEAPPPAA |
Ga0307475_105466952 | 3300031754 | Hardwood Forest Soil | MSTVLGLLAFVVFIVAIIGVAAGVTWVVVRFSPAKKPDAPPPAA |
Ga0307479_111629592 | 3300031962 | Hardwood Forest Soil | MGAVLGLLAFVLFIVAIIGAAAGITWVVVRLSPPQQKPDATPKA |
Ga0307479_120739621 | 3300031962 | Hardwood Forest Soil | LLAFVVFIVLVIALAAAVTWVVVRVSPSKKQPDAAPKT |
Ga0318562_105707322 | 3300032008 | Soil | MADVLGILLFAVFIVVIIAAAAGVTWVVVRVSPAKKPAEAPKA |
Ga0316583_100602132 | 3300032133 | Rhizosphere | MTTALGLLAFVLYIAVVIGAAAGITWVVVRYSPTKKPDATQKS |
Ga0307472_1024090871 | 3300032205 | Hardwood Forest Soil | LTTVLGLLAFVVFIVAIIGVAAGVTWLVVRLSPPKTPGATPNKT |
Ga0335079_103695352 | 3300032783 | Soil | VSTALGLIGFVVFIVVVIATAAGVTWVVVRFSPAKKPKASTPS |
Ga0335080_109881152 | 3300032828 | Soil | MGDVLGLLLFAVFIVVIIAMAAGITWVVVRLSPAKKPAETPQA |
Ga0335070_100309697 | 3300032829 | Soil | VSTVLGLLAFVVFIAAVIATAAGVTWVVVQLSPAKKPKTPAPS |
Ga0335081_101123582 | 3300032892 | Soil | MTTILGLLAFVLFIACVIGLAAGITWVVVRLSPAKKPDAA |
Ga0335081_101929403 | 3300032892 | Soil | MSNVLGLLAFVLFIVAIIGAAAGITWVVVRLSPPQPKPDATPKA |
Ga0335081_108919812 | 3300032892 | Soil | VSTALGLIGFVVFIVVVIATAAGVTWVVVRFSPAKKPKPSAHS |
Ga0334722_100940753 | 3300033233 | Sediment | VSDVFGLFFFVVFILCIVAAAAGITWVVVRVSPAKKPDATPKT |
Ga0314865_083447_72_203 | 3300033806 | Peatland | MSTALGLIAFVAFIVAVIAVAAGVTWVVVRVSPAKKSEPAKPS |
Ga0314867_008440_2267_2398 | 3300033808 | Peatland | MTTVLGLLAFVVFIGVVIATAAGVTWVVVRFSPAKKPKPSAPS |
⦗Top⦘ |