| Basic Information | |
|---|---|
| Family ID | F099080 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRDLVADWKKWSSAERLLAVVLVLMLIGLPLRVLIAGAPL |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 1.94 % |
| % of genes from short scaffolds (< 2000 bps) | 5.83 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.117 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (22.330 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.010 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF05494 | MlaC | 24.27 |
| PF13384 | HTH_23 | 2.91 |
| PF01527 | HTH_Tnp_1 | 1.94 |
| PF01548 | DEDD_Tnp_IS110 | 0.97 |
| PF02566 | OsmC | 0.97 |
| PF05239 | PRC | 0.97 |
| PF00211 | Guanylate_cyc | 0.97 |
| PF05598 | DUF772 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 24.27 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.97 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.97 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.12 % |
| All Organisms | root | All Organisms | 3.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300010040|Ga0126308_10132677 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300010041|Ga0126312_10208166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1368 | Open in IMG/M |
| 3300010044|Ga0126310_10191782 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300012207|Ga0137381_11192186 | Not Available | 654 | Open in IMG/M |
| 3300012212|Ga0150985_117771173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1315 | Open in IMG/M |
| 3300012957|Ga0164303_10450869 | Not Available | 810 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 22.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.77% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003572 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1045818462 | 3300000364 | Soil | MRDFMADWKKWGSVERLLAVVLALVLIGLPLRALIGATPL* |
| C688J18823_100380414 | 3300001686 | Soil | MRDLLADWRKWSSTERLLAVVLTLMLLGMPLRALISVAPF* |
| C688J18823_100783492 | 3300001686 | Soil | MRDLAADWKRWSSTERLLAVVLMLMLIGLPLRVLIAGAPL* |
| C688J18823_108011292 | 3300001686 | Soil | MRDLMADWNKWSSAERLLAVVLMLMLIGLPLRVFIAGAPS* |
| C688J35102_1182822211 | 3300002568 | Soil | MRDLVADWKRWSAAERLLAMILISILIGLPLRALIASTPL |
| C688J35102_1197518102 | 3300002568 | Soil | MRDLMADWNKWSSAERLLAVVLMLLLIGLPLRVFIAGPPL* |
| C688J35102_1199675712 | 3300002568 | Soil | MRDLMADWKKWTSVERLLAVVLTLMLIGLPFRVLITATPL* |
| C688J35102_1208082792 | 3300002568 | Soil | MRDLMADWNKWSSAERLLAVVLMLMLIGLPLRIFIAGPPL* |
| Ga0007424J51698_10387631 | 3300003572 | Avena Fatua Rhizosphere | RAQLRRRRGEMRDLMADWNKWSSAERLLAAVLMLMLIGLPLRVWVVGTPL* |
| Ga0063454_1013102041 | 3300004081 | Soil | MRDLMADWNKWSSAERLLAVVLMLLLIGFPLRIFIAGPPL* |
| Ga0063455_1010648461 | 3300004153 | Soil | GMRDLMADWNKWSSAERLLAVVLTLMLIGLPLQVFIAEAPR* |
| Ga0062589_1016001481 | 3300004156 | Soil | MRDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLITGNPL* |
| Ga0062592_1007308972 | 3300004480 | Soil | MHDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLITGNPL* |
| Ga0062592_1011755671 | 3300004480 | Soil | MRDLMADWNKWSSAERLLAVVLMLMLIGMPLRVFIAGAPG* |
| Ga0062591_1013117692 | 3300004643 | Soil | MRDLVADWKKWSSAERLLAMLLILMLIGLPLRILVTVTPL* |
| Ga0062594_1018886222 | 3300005093 | Soil | MRDLMADWNKWSSAERLLAAVLMLMLIGLPLRVWVVGIPL* |
| Ga0070683_1007172002 | 3300005329 | Corn Rhizosphere | MRDLMADWNKWSSAERLLAAVLMLMLIGLPLRVWVVGTPL* |
| Ga0070683_1023629201 | 3300005329 | Corn Rhizosphere | MRDLAADWKRWSAAERLLAVVLTLMLIGLPLRVLIAGAPL* |
| Ga0070690_1017610941 | 3300005330 | Switchgrass Rhizosphere | MRNLMADWNKWSSAERLLAAVLMLMLIGLPLRVWVVGTPL* |
| Ga0070666_113485681 | 3300005335 | Switchgrass Rhizosphere | MRDLTADWQKWSSAERFLAVVLVLVLIGLPLRFLITTAPL* |
| Ga0070668_1011370031 | 3300005347 | Switchgrass Rhizosphere | EMRDLAADWKRWNSAERLLAVILMLTLIGLPLRVLIAGAPL* |
| Ga0070671_1004891511 | 3300005355 | Switchgrass Rhizosphere | MAIRDFTTDWKKWSSAERFLAVVLMLMLIGLPLSFLITTAPL* |
| Ga0070685_104937681 | 3300005466 | Switchgrass Rhizosphere | WKERGMRDLIADWNKWSSAERLLAVTLTVMLIGLPLRIFIAGPPL* |
| Ga0070685_106777892 | 3300005466 | Switchgrass Rhizosphere | MRDLMADWNKWSSAERLLAVVLMLMLIGMPLRVFIAGAPS* |
| Ga0070686_1013443231 | 3300005544 | Switchgrass Rhizosphere | MRDLVADWNKWSSAERLLAAVLMLTLIGLPLRSLIASTLL* |
| Ga0070664_1023377471 | 3300005564 | Corn Rhizosphere | LVRWKERGMRDLMADWNKWSSAERLLAVVLTVMLIGLPLRIFIAGPPL* |
| Ga0068852_1021509451 | 3300005616 | Corn Rhizosphere | MRDLAADWEKWNSAERLLAVILVLVLIGLPLRVLI |
| Ga0068866_102917171 | 3300005718 | Miscanthus Rhizosphere | MRDLMADWNKWSSAERLLAVVLMLMLIGMPLRVFIA |
| Ga0068861_1017354412 | 3300005719 | Switchgrass Rhizosphere | VRTLAAYAKERGMRDLMADWNKWSSAERLLAVVLMLMLIGMPLRVFIAGAPS* |
| Ga0068863_1014737082 | 3300005841 | Switchgrass Rhizosphere | MHDLMADWKKWTSAERLLAVVLTLMLIGLPLRVLIIATPL* |
| Ga0068863_1015839781 | 3300005841 | Switchgrass Rhizosphere | MRDLVADWRKWSSAERLLAMVLILVLIGLPLRILITVTPL* |
| Ga0079222_118257661 | 3300006755 | Agricultural Soil | MRDLMADWNKWSSTERLLAVVLMLILIGLPLRVFIAGAPS* |
| Ga0079220_102628151 | 3300006806 | Agricultural Soil | MRDLAADWKKWSAAERLLAVALVLMLIGLPLRVLIVGAPL* |
| Ga0079219_118566582 | 3300006954 | Agricultural Soil | MRDLIADWNKWSSAERLLAVVLMLMLIGLPLQVFIAETPS* |
| Ga0105243_121838922 | 3300009148 | Miscanthus Rhizosphere | MRDLLADWKRWSAAERLLAMILISILIGLPLRALIASTPL* |
| Ga0105249_106623673 | 3300009553 | Switchgrass Rhizosphere | MRDLMADWDKWSSAERLLAVVLMLMLIGMPLRVFIAGAPG* |
| Ga0126307_100808144 | 3300009789 | Serpentine Soil | MRDLTADWKKWNSAERLLAVVLTLMLLGFPLRVLITAPL* |
| Ga0126307_103345742 | 3300009789 | Serpentine Soil | MRDLVADWKKWSSAERLLVAVLVLMLIGLPLRVLIAGSPL* |
| Ga0126313_103306301 | 3300009840 | Serpentine Soil | DLMADWNKWSSAERLLAVVLTLMLIGLPLQVFIAEAPR* |
| Ga0126305_101467502 | 3300010036 | Serpentine Soil | MRDLTADWKKWNSAERLLAVVLTLMLLGLPLRVLITAPL* |
| Ga0126304_106599892 | 3300010037 | Serpentine Soil | MADLVADWKKWSSVERLLAVVLMMMLIGLPLRALITAVPL* |
| Ga0126304_112273862 | 3300010037 | Serpentine Soil | MGMRDLVADWKKWGSAERLLAVVLVVMLVGLPLRALITAAPL* |
| Ga0126309_106769791 | 3300010039 | Serpentine Soil | MADWNKWNSAERLLAVILVLTLIGLPLRILIAGAPL |
| Ga0126309_112974821 | 3300010039 | Serpentine Soil | MRDLMADWNKWSSAERLLAVVLILMLIGLPLRVFIAGAPS* |
| Ga0126308_101326773 | 3300010040 | Serpentine Soil | MRDLMADWNKWSSAERLLAVVLTLMLIGLPLQVFIAEAPR* |
| Ga0126308_104534482 | 3300010040 | Serpentine Soil | MRDLVADWKKWSSAERPLVAVLVLMLIGLPLRVLIAGSPL* |
| Ga0126312_102081663 | 3300010041 | Serpentine Soil | LVADWKKWSSTERLLAMVLVLMLIGLPLRVLIAGAPL* |
| Ga0126312_105402252 | 3300010041 | Serpentine Soil | MRDLLADWKKWNAAERLLALVLALTLISLPLRILISTAPL* |
| Ga0126312_106374461 | 3300010041 | Serpentine Soil | LEGVGEMRDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLIAGAPL* |
| Ga0126312_108301012 | 3300010041 | Serpentine Soil | MRDLLADWNKWNSAERLLALVLALTLISLPLRILATTAPL* |
| Ga0126312_112000292 | 3300010041 | Serpentine Soil | MRDLVADWKKWSSAERLLAVVLVLMLIGLPLRVLIAGAPL* |
| Ga0126312_114413252 | 3300010041 | Serpentine Soil | MRDLVTDWKRWSSAERLLAMVLMLMFIGLPLRVLIAGAPL* |
| Ga0126314_105773772 | 3300010042 | Serpentine Soil | MRDLVADWKKWSSTERLLAMVLMLILIGLPSRVLIAGAPL* |
| Ga0126310_101917821 | 3300010044 | Serpentine Soil | MRDLMADWNKWSSAERLLAVVLMLVLIGLPLRVFIAGVPS* |
| Ga0126310_104651722 | 3300010044 | Serpentine Soil | MRDLLADWNKWNSAERLLALVLALTLISLPLRILITTAPL* |
| Ga0126310_106860721 | 3300010044 | Serpentine Soil | RREEMRDLMADWKKWTSVERLLAVVLTLMLIGLPFRVLITATPL* |
| Ga0126311_102724742 | 3300010045 | Serpentine Soil | MRDLAADWKRWSSAERLLAVVLVLTLIGLPLRVLIAGAPL* |
| Ga0126311_103094722 | 3300010045 | Serpentine Soil | MRDLVADWKKWSSAERLLAMVLMLMLIGLPLRVLIAGAPL* |
| Ga0126311_118237931 | 3300010045 | Serpentine Soil | MRDLAADWKKWNSAERLLAVILVLTLIGLPLRVLIAGAPL* |
| Ga0126373_131986991 | 3300010048 | Tropical Forest Soil | DWKKWGSAERLLALVLGLALIGLLLRALITAAPL* |
| Ga0126373_132577301 | 3300010048 | Tropical Forest Soil | MRDFMADWKKWGSVERLLAVVLALVLIGLPLRALIGAAPL* |
| Ga0126317_106548422 | 3300011332 | Soil | MRDLVADWKKWSSTERLLAMVLVLMLIGLPLRVLIAGAPL* |
| Ga0137381_111921862 | 3300012207 | Vadose Zone Soil | MRDLLADWKKWSSTERLLAVVLMVMLLGLPLKGLISAAPF* |
| Ga0150985_1072703381 | 3300012212 | Avena Fatua Rhizosphere | PQLVHWKERGMRDLMADWNKWSSAERLLAIVLTVMLIGLPLRIFIAGPPL* |
| Ga0150985_1109303861 | 3300012212 | Avena Fatua Rhizosphere | RSRVRWKEKRMRDLMADWNKWSSAERLLAVVLTVMLVGLPLRVFIAGAPG* |
| Ga0150985_1177711732 | 3300012212 | Avena Fatua Rhizosphere | MRDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLIAGAPL* |
| Ga0150985_1179558303 | 3300012212 | Avena Fatua Rhizosphere | MKMRDLLADWNKWNSAERLLALVLALTLISLPLRILITTAPL* |
| Ga0150985_1189724543 | 3300012212 | Avena Fatua Rhizosphere | RDLMADWNKWSSAERLLAVVLMLMLIGLPLRIFIAGPQL* |
| Ga0150985_1205693601 | 3300012212 | Avena Fatua Rhizosphere | ADWNKWSSAERLLAVVLMLMLIGLPLRVFIAGVPR* |
| Ga0137385_114990562 | 3300012359 | Vadose Zone Soil | MRDLLADWRKWSSAERLLAMVLILVLIGLPFRVLITVTPF* |
| Ga0134034_11614512 | 3300012375 | Grasslands Soil | MRDLVADWKRWSAAERLLAMILISILIGLPLRALIASTPL* |
| Ga0134053_13857091 | 3300012406 | Grasslands Soil | RDLAADWKRWSSTERLLAVVLMLMLIGLPLRVLIAGAPL* |
| Ga0150984_1087047821 | 3300012469 | Avena Fatua Rhizosphere | RIYVRWKERGMRDLMADWNKWTSAERLLAVVLMLMLIGLPLRVFIAGVPR* |
| Ga0150984_1169460132 | 3300012469 | Avena Fatua Rhizosphere | ADWNKWSSAERLLAVVLMLMLIGLPLRVFIAGAPS* |
| Ga0150984_1193415292 | 3300012469 | Avena Fatua Rhizosphere | HTQLARWKERGMRDLMADWNKWSFAERLLAVVLTVMLIGLPLRIFIAGPPL* |
| Ga0150984_1205818673 | 3300012469 | Avena Fatua Rhizosphere | VRWKERGMRDLMADWNKWSSAERLLAVVLTVMLVGLPLRVFIAGAPG* |
| Ga0164298_101862071 | 3300012955 | Soil | MRDLTADWKKWTSAERLLAVVLTLMLIGVPLQVFIAEAPR* |
| Ga0164298_111738041 | 3300012955 | Soil | MRDLMADWKKWSSAERLLAVVLTLMLIGLPIRVFISGVPS* |
| Ga0164303_104508693 | 3300012957 | Soil | MRDLMADWKKWTSAERLLAVVLTLMLIGLPFRVLIIAT |
| Ga0164309_109905952 | 3300012984 | Soil | MRDLAADWKKWNSVERLLAIILVLILIGLPLRVLIA |
| Ga0163163_109069691 | 3300014325 | Switchgrass Rhizosphere | MRDLMADWNKWTSTERLLAVVLMLTLIGLPLRVFIAGVPS* |
| Ga0182000_105675832 | 3300014487 | Soil | MRDLVADWKRWSSAERLLAVVLVLMLIGLPLRVLIAGA |
| Ga0182008_104427802 | 3300014497 | Rhizosphere | MRDLAADWKKWSVAERLLAVALVLMLIGLPLRVLIVGAPL* |
| Ga0157377_107358711 | 3300014745 | Miscanthus Rhizosphere | VHTQLVRWKERGMRDLMADWNKWSSAERLLAVVLTVMLIGLPLRIFIAGPPL* |
| Ga0132258_123589682 | 3300015371 | Arabidopsis Rhizosphere | MRDLLADWKKWNSVERLLAVVLVLMLIGLPLRALITAGPL* |
| Ga0132258_136580262 | 3300015371 | Arabidopsis Rhizosphere | MADWNKWNSAERLLAVVLTLTLLGFPLQVLITAASL* |
| Ga0132255_1027895602 | 3300015374 | Arabidopsis Rhizosphere | ERAMRDLLADWKKWNSVERLLAVVLVLMLIGLPLRALITAGPL* |
| Ga0163161_106365262 | 3300017792 | Switchgrass Rhizosphere | MRDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLITGNLL |
| Ga0163161_117517852 | 3300017792 | Switchgrass Rhizosphere | MRDLLADWKRWSAAERLLAMILISILIGLPLRALIASTPL |
| Ga0190269_103992291 | 3300018465 | Soil | MRDLVADWKRWSSAERLLAMVLMLMLIGLPLRVLIAGAPL |
| Ga0173482_103475101 | 3300019361 | Soil | MRDLMADWNKWSSAERLLAVVLMLMLIGMPLRVFIAEAPG |
| Ga0190264_101260591 | 3300019377 | Soil | MRDLMADWNKWSSAERLLAVVLMLMLIGLPLQLFIAGPPL |
| Ga0190264_110055721 | 3300019377 | Soil | MRDLVADWKRWSSTERLLVVFLMLMLIGLPLRVLIAGAPL |
| Ga0196959_100535341 | 3300021184 | Soil | RLIAHKELGMRDLAADWKRWNSAERLLAVVLMLMLIGLPLRVLIAGAPL |
| Ga0207687_115663821 | 3300025927 | Miscanthus Rhizosphere | MRDLMADWNKWSSAERLLAAVLMLMLIGLPLRVWVVGTPL |
| Ga0207686_111406321 | 3300025934 | Miscanthus Rhizosphere | MRDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLITGNPL |
| Ga0207669_105305372 | 3300025937 | Miscanthus Rhizosphere | MRDLLADWKRWSAAERLLAMIVISILIGLPLRALIASTPL |
| Ga0207704_107017542 | 3300025938 | Miscanthus Rhizosphere | MRDLMADWNKWSSAERLLAVVLMLMLIGMPLRVFIAGAPG |
| Ga0207668_112433312 | 3300025972 | Switchgrass Rhizosphere | AQSQGLGMRDLVADWKRWSAAERLLAAVLMLMLIGLPLRVLIAGAPL |
| Ga0207658_102596393 | 3300025986 | Switchgrass Rhizosphere | MRDLTADWQKWSSAERFLAVVLVLVLIGLPLRFLITTAPL |
| Ga0207676_114126811 | 3300026095 | Switchgrass Rhizosphere | MHDLVADWKKWSSTERLLAMVLMLMLIGLPLRVLITGNLL |
| Ga0207698_126360561 | 3300026142 | Corn Rhizosphere | MRDLVADWNKWSSAERLLAAVLMLTLIGLPLRSLIASTLL |
| Ga0308175_1024637632 | 3300031938 | Soil | MRDLAADWKKWSAAERLLAVALVLMLIGLPLRVLIVGAPL |
| ⦗Top⦘ |