| Basic Information | |
|---|---|
| Family ID | F099065 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 39.81 % |
| % of genes near scaffold ends (potentially truncated) | 36.89 % |
| % of genes from short scaffolds (< 2000 bps) | 69.90 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.573 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (64.078 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.553 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (84.466 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.50% Coil/Unstructured: 97.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 41.75 |
| PF07690 | MFS_1 | 24.27 |
| PF12399 | BCA_ABC_TP_C | 12.62 |
| PF02653 | BPD_transp_2 | 5.83 |
| PF09334 | tRNA-synt_1g | 0.97 |
| PF03352 | Adenine_glyco | 0.97 |
| PF00127 | Copper-bind | 0.97 |
| PF00211 | Guanylate_cyc | 0.97 |
| PF14890 | Intein_splicing | 0.97 |
| PF01850 | PIN | 0.97 |
| PF03446 | NAD_binding_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.97 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.43 % |
| Unclassified | root | N/A | 47.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10008275 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3690 | Open in IMG/M |
| 3300005166|Ga0066674_10029122 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2431 | Open in IMG/M |
| 3300005166|Ga0066674_10042914 | Not Available | 2025 | Open in IMG/M |
| 3300005166|Ga0066674_10228214 | Not Available | 885 | Open in IMG/M |
| 3300005166|Ga0066674_10228215 | Not Available | 885 | Open in IMG/M |
| 3300005167|Ga0066672_10541426 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005167|Ga0066672_10570197 | Not Available | 733 | Open in IMG/M |
| 3300005172|Ga0066683_10290720 | Not Available | 1015 | Open in IMG/M |
| 3300005174|Ga0066680_10003344 | All Organisms → cellular organisms → Archaea | 7316 | Open in IMG/M |
| 3300005174|Ga0066680_10024658 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3335 | Open in IMG/M |
| 3300005175|Ga0066673_10001242 | All Organisms → cellular organisms → Archaea | 8597 | Open in IMG/M |
| 3300005176|Ga0066679_10018494 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3645 | Open in IMG/M |
| 3300005179|Ga0066684_10087247 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1884 | Open in IMG/M |
| 3300005186|Ga0066676_10846955 | Not Available | 616 | Open in IMG/M |
| 3300005187|Ga0066675_10045203 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2679 | Open in IMG/M |
| 3300005446|Ga0066686_10455461 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 873 | Open in IMG/M |
| 3300005447|Ga0066689_10997511 | Not Available | 515 | Open in IMG/M |
| 3300005450|Ga0066682_10347497 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 955 | Open in IMG/M |
| 3300005451|Ga0066681_10591832 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005540|Ga0066697_10485108 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005540|Ga0066697_10832500 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 501 | Open in IMG/M |
| 3300005552|Ga0066701_10894056 | Not Available | 526 | Open in IMG/M |
| 3300005553|Ga0066695_10685262 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005554|Ga0066661_10762535 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005554|Ga0066661_10951266 | Not Available | 502 | Open in IMG/M |
| 3300005556|Ga0066707_10076326 | Not Available | 2011 | Open in IMG/M |
| 3300005558|Ga0066698_11056108 | Not Available | 514 | Open in IMG/M |
| 3300005559|Ga0066700_10353500 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1037 | Open in IMG/M |
| 3300005561|Ga0066699_10611774 | Not Available | 782 | Open in IMG/M |
| 3300005568|Ga0066703_10096304 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1734 | Open in IMG/M |
| 3300005574|Ga0066694_10336285 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005576|Ga0066708_10541914 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005576|Ga0066708_10702234 | Not Available | 640 | Open in IMG/M |
| 3300005586|Ga0066691_10027138 | Not Available | 2921 | Open in IMG/M |
| 3300005598|Ga0066706_11057404 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006031|Ga0066651_10465241 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 671 | Open in IMG/M |
| 3300006791|Ga0066653_10070531 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1512 | Open in IMG/M |
| 3300006791|Ga0066653_10110104 | Not Available | 1273 | Open in IMG/M |
| 3300006794|Ga0066658_10578676 | Not Available | 611 | Open in IMG/M |
| 3300006796|Ga0066665_10459404 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1049 | Open in IMG/M |
| 3300006796|Ga0066665_10463171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1044 | Open in IMG/M |
| 3300006796|Ga0066665_10554725 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 933 | Open in IMG/M |
| 3300006797|Ga0066659_10626095 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 875 | Open in IMG/M |
| 3300006797|Ga0066659_10633474 | Not Available | 870 | Open in IMG/M |
| 3300009012|Ga0066710_101039645 | Not Available | 1265 | Open in IMG/M |
| 3300009012|Ga0066710_103006097 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 656 | Open in IMG/M |
| 3300010303|Ga0134082_10210891 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 797 | Open in IMG/M |
| 3300010304|Ga0134088_10347947 | Not Available | 719 | Open in IMG/M |
| 3300010323|Ga0134086_10055363 | Not Available | 1352 | Open in IMG/M |
| 3300010329|Ga0134111_10333365 | Not Available | 638 | Open in IMG/M |
| 3300010337|Ga0134062_10037962 | Not Available | 1926 | Open in IMG/M |
| 3300012198|Ga0137364_10349477 | Not Available | 1103 | Open in IMG/M |
| 3300012199|Ga0137383_10891211 | Not Available | 649 | Open in IMG/M |
| 3300012204|Ga0137374_10130334 | Not Available | 2290 | Open in IMG/M |
| 3300012206|Ga0137380_10141931 | Not Available | 2190 | Open in IMG/M |
| 3300012206|Ga0137380_11052016 | Not Available | 694 | Open in IMG/M |
| 3300012207|Ga0137381_10011594 | Not Available | 6753 | Open in IMG/M |
| 3300012207|Ga0137381_11311735 | Not Available | 617 | Open in IMG/M |
| 3300012209|Ga0137379_10020386 | All Organisms → cellular organisms → Archaea | 6368 | Open in IMG/M |
| 3300012210|Ga0137378_10421658 | Not Available | 1237 | Open in IMG/M |
| 3300012211|Ga0137377_10001781 | All Organisms → cellular organisms → Archaea | 15421 | Open in IMG/M |
| 3300012211|Ga0137377_10985616 | Not Available | 774 | Open in IMG/M |
| 3300012349|Ga0137387_10372169 | Not Available | 1035 | Open in IMG/M |
| 3300012353|Ga0137367_10453805 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 905 | Open in IMG/M |
| 3300012353|Ga0137367_10730086 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012356|Ga0137371_10034726 | All Organisms → cellular organisms → Bacteria | 3894 | Open in IMG/M |
| 3300012357|Ga0137384_10455703 | Not Available | 1053 | Open in IMG/M |
| 3300012976|Ga0134076_10052365 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1543 | Open in IMG/M |
| 3300015357|Ga0134072_10170740 | Not Available | 731 | Open in IMG/M |
| 3300015358|Ga0134089_10365124 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 611 | Open in IMG/M |
| 3300017654|Ga0134069_1278514 | Not Available | 588 | Open in IMG/M |
| 3300017656|Ga0134112_10297480 | Not Available | 648 | Open in IMG/M |
| 3300018431|Ga0066655_10019315 | Not Available | 3144 | Open in IMG/M |
| 3300018431|Ga0066655_11060723 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 564 | Open in IMG/M |
| 3300018468|Ga0066662_12627291 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 532 | Open in IMG/M |
| 3300018482|Ga0066669_10404258 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1157 | Open in IMG/M |
| 3300026296|Ga0209235_1007882 | All Organisms → cellular organisms → Archaea | 5956 | Open in IMG/M |
| 3300026307|Ga0209469_1027264 | Not Available | 1949 | Open in IMG/M |
| 3300026307|Ga0209469_1102618 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300026309|Ga0209055_1000919 | All Organisms → cellular organisms → Archaea | 19746 | Open in IMG/M |
| 3300026309|Ga0209055_1020685 | Not Available | 3169 | Open in IMG/M |
| 3300026314|Ga0209268_1010683 | All Organisms → cellular organisms → Archaea | 3707 | Open in IMG/M |
| 3300026315|Ga0209686_1075494 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1196 | Open in IMG/M |
| 3300026316|Ga0209155_1004167 | Not Available | 6502 | Open in IMG/M |
| 3300026317|Ga0209154_1000212 | All Organisms → cellular organisms → Archaea | 41909 | Open in IMG/M |
| 3300026317|Ga0209154_1008967 | All Organisms → cellular organisms → Archaea | 4951 | Open in IMG/M |
| 3300026324|Ga0209470_1001746 | All Organisms → cellular organisms → Archaea | 15827 | Open in IMG/M |
| 3300026325|Ga0209152_10000288 | All Organisms → cellular organisms → Archaea | 24869 | Open in IMG/M |
| 3300026328|Ga0209802_1011331 | Not Available | 5231 | Open in IMG/M |
| 3300026329|Ga0209375_1055117 | Not Available | 1958 | Open in IMG/M |
| 3300026329|Ga0209375_1113830 | Not Available | 1198 | Open in IMG/M |
| 3300026330|Ga0209473_1062202 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1601 | Open in IMG/M |
| 3300026333|Ga0209158_1042485 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1903 | Open in IMG/M |
| 3300026335|Ga0209804_1121851 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1183 | Open in IMG/M |
| 3300026342|Ga0209057_1179264 | Not Available | 612 | Open in IMG/M |
| 3300026532|Ga0209160_1291430 | Not Available | 554 | Open in IMG/M |
| 3300026536|Ga0209058_1337356 | Not Available | 521 | Open in IMG/M |
| 3300026538|Ga0209056_10094512 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300026538|Ga0209056_10097635 | Not Available | 2409 | Open in IMG/M |
| 3300026542|Ga0209805_1002723 | All Organisms → cellular organisms → Archaea | 10264 | Open in IMG/M |
| 3300026547|Ga0209156_10326167 | Not Available | 683 | Open in IMG/M |
| 3300026550|Ga0209474_10546026 | Not Available | 589 | Open in IMG/M |
| 3300026552|Ga0209577_10001576 | All Organisms → cellular organisms → Archaea | 22540 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 64.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100082753 | 3300002558 | Grasslands Soil | MKRPRRREEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066674_100291222 | 3300005166 | Soil | LPGPFLFMKSPRRREETEKNTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066674_100429142 | 3300005166 | Soil | MKSPRRREEKEKNTAKTPKTIDVDDAGRLYSLDTWVKKTP* |
| Ga0066674_102282142 | 3300005166 | Soil | KMVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0066674_102282152 | 3300005166 | Soil | KMVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRL* |
| Ga0066672_105414262 | 3300005167 | Soil | MKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066672_105701971 | 3300005167 | Soil | RMVLPGPFFFMKRPRRREEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066683_102907202 | 3300005172 | Soil | RRMVLPGPFLFMKSPRRREENEKNMAKTPKTMDVDEAGRLYSPDTWVKKTP* |
| Ga0066680_100033447 | 3300005174 | Soil | MVLPGPFLFMKRPRRSEEKEKSTAKTPKTIDVADAGRLYSLDTGVKKIP* |
| Ga0066680_100246584 | 3300005174 | Soil | MKRPRRMEEKENSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066673_1000124210 | 3300005175 | Soil | MRRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066679_100184944 | 3300005176 | Soil | MKRPRRREEKENSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066684_100872472 | 3300005179 | Soil | MKRPRRREEKEKNTANTPKTIDVDDAGRLYSLDTRVKKTP* |
| Ga0066676_108469551 | 3300005186 | Soil | GPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSMDTRVKKTP* |
| Ga0066675_100452035 | 3300005187 | Soil | MKRPRKREEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066686_104554612 | 3300005446 | Soil | LPGPFLFMKSPRRREENEKNTAKTPKTMDVDDAGRLYFPDTWVKKTP* |
| Ga0066689_109975112 | 3300005447 | Soil | SRMVLPGPFLFMKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066682_103474972 | 3300005450 | Soil | LPGPFLFMKSPRRREENEKNTAKTPKTMDVDDAGRSYSPDTWVKKTP* |
| Ga0066681_105918322 | 3300005451 | Soil | MKSPRRREETEKNTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066697_104851082 | 3300005540 | Soil | MKRPRRREEKEKSTAKTPKTIDVADAGRLYSLDT* |
| Ga0066697_108325002 | 3300005540 | Soil | LPGPFLFMKSPRRREEKEKNTAKTPKTMDVDDAGRLYFPDTWVKKTP* |
| Ga0066701_108940561 | 3300005552 | Soil | PGPFLFMKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066695_106852622 | 3300005553 | Soil | MKRPRRREEKEKSTAKTPKTIDVADAGRLYSLDTRVKKTP* |
| Ga0066661_107625352 | 3300005554 | Soil | MKRPRRMEEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066661_109512662 | 3300005554 | Soil | VLPGPFLFMKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066707_100763264 | 3300005556 | Soil | MKRPRRMEEKENSTAKTPKTMDVAEAGRLYSLDTRVKKTP* |
| Ga0066698_110561081 | 3300005558 | Soil | KMVFPGPFLLMKSPRRREEKEKNTANTPKMMDVDDAGRLYSLDIRVKNTP* |
| Ga0066700_103535002 | 3300005559 | Soil | MKRPRRREEKERSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066699_106117741 | 3300005561 | Soil | REEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0066703_100963042 | 3300005568 | Soil | MKRPRSREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066694_103362852 | 3300005574 | Soil | LPGPFLFMKSPRRREENEKNTAKTPKTMDVDEAGRLYSPDTWVKKTP* |
| Ga0066708_105419142 | 3300005576 | Soil | MKRPRRSEEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0066708_107022341 | 3300005576 | Soil | RPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066691_100271383 | 3300005586 | Soil | LPGPFLFMKRPRRREEKENSTAKTPKTMDVADAGRLYSLDTREKKTP* |
| Ga0066706_110574042 | 3300005598 | Soil | MKRPRRREEKEKSTAKTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066651_104652412 | 3300006031 | Soil | MKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066653_100705312 | 3300006791 | Soil | MKRPRRREEKEKSTAKTPKTMDVADAGSLYSLDILVKKTP* |
| Ga0066653_101101041 | 3300006791 | Soil | RRREEKEKNTAKTPKTIDVDDAGRLYSLDTWVKKTP* |
| Ga0066658_105786761 | 3300006794 | Soil | PFLFMKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0066665_104594042 | 3300006796 | Soil | MLMKIPRRREEKEKNTAKTPKTMDVDEAGKLYSPDTWVKKTP* |
| Ga0066665_104631712 | 3300006796 | Soil | MKRPRRREEKEKSTAKTPKTMDVADAGRLYSLDILVKKTP* |
| Ga0066665_105547252 | 3300006796 | Soil | MKSPRRREENEKNMAKTPKTMDVDEAGRLYSPDTWVKKTP* |
| Ga0066659_106260952 | 3300006797 | Soil | MKRPRRREEKEKSTAKTPKTIDVAEAGRLYSLDTRVKKTP* |
| Ga0066659_106334742 | 3300006797 | Soil | VFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSMDTRVKKTP* |
| Ga0066710_1010396453 | 3300009012 | Grasslands Soil | VFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSMDTRVKKTP |
| Ga0066710_1030060972 | 3300009012 | Grasslands Soil | MKRPRRSEEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0134082_102108912 | 3300010303 | Grasslands Soil | MKSPRRREENEKNTAKTPKTMDVDEAGRLYSPDTWVKKTP* |
| Ga0134088_103479472 | 3300010304 | Grasslands Soil | GPFLFMKRPRRREEKEKSTAKTPKTIDVADAGRLYSLDTRVKKTP* |
| Ga0134086_100553631 | 3300010323 | Grasslands Soil | RREEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0134111_103333651 | 3300010329 | Grasslands Soil | RMVLPGPFLFMKRPRRREEKEKSTAKTPKTIDVADAGRLYSLDT* |
| Ga0134062_100379624 | 3300010337 | Grasslands Soil | PRRREEKEKNTANTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0137364_103494771 | 3300012198 | Vadose Zone Soil | MVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0137383_108912111 | 3300012199 | Vadose Zone Soil | KMVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0137374_101303343 | 3300012204 | Vadose Zone Soil | MKSPRRREEKEKNTAKTPKTIDVDDAGRLYFPDTWVKKTP* |
| Ga0137380_101419314 | 3300012206 | Vadose Zone Soil | VLINPPPSKMVFPGPFLLMKSPRRREEKEKNTAKTPKTMDVDDAGKLYSLDIRVKKTP* |
| Ga0137380_110520162 | 3300012206 | Vadose Zone Soil | SKMVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0137381_100115942 | 3300012207 | Vadose Zone Soil | MKRPRRSEEKENSTAKTPKTMDVAEAGRLYSLDTRVKKTP* |
| Ga0137381_113117352 | 3300012207 | Vadose Zone Soil | PPSKMVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0137379_100203863 | 3300012209 | Vadose Zone Soil | MKSPRRREEKEKNTAKTPKTMDVDDAGKLYSLDIRVKKTP* |
| Ga0137378_104216583 | 3300012210 | Vadose Zone Soil | PSKMVFPGPFLLMKSPRRREEKEKNTAKTPKTMDVDDAGKLYSLDIRVKKTP* |
| Ga0137377_100017814 | 3300012211 | Vadose Zone Soil | MREENEKNMAKTPKTMDVDEAGRLYSPDTWVKKTP* |
| Ga0137377_109856162 | 3300012211 | Vadose Zone Soil | FPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0137387_103721693 | 3300012349 | Vadose Zone Soil | FLLMKSPRRREEKEKNTAKTPKMMDVDEAGKLYSLDTRVKKTP* |
| Ga0137367_104538052 | 3300012353 | Vadose Zone Soil | MKRPRRREEREKSTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0137367_107300862 | 3300012353 | Vadose Zone Soil | MKSPRRREEKEKNTAKTPKTMDVADAGRLYSLDTRVKKTP* |
| Ga0137371_100347263 | 3300012356 | Vadose Zone Soil | MKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDKRVKKTP* |
| Ga0137384_104557031 | 3300012357 | Vadose Zone Soil | PGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP* |
| Ga0134076_100523653 | 3300012976 | Grasslands Soil | MKSPRRREETEKNTAKTPKTMDVDDAGRSYSPDTWVKKTP* |
| Ga0134072_101707401 | 3300015357 | Grasslands Soil | RMVLPGPFLFMRRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP* |
| Ga0134089_103651242 | 3300015358 | Grasslands Soil | MKSPRRKAEKEKKTANMPKTMDVDDAGRLYFPDTWVKKTP* |
| Ga0134069_12785141 | 3300017654 | Grasslands Soil | MVLPGPFLFMKSPRRREEKEKNTAKTPKTIDVDDAGRLYSLDTWVKKTP |
| Ga0134112_102974802 | 3300017656 | Grasslands Soil | LPGPFLFIKSPRRREEKEKNTAKTPNTMDVDDAGRLYSLDTWVKKTP |
| Ga0066655_100193153 | 3300018431 | Grasslands Soil | LPGPFLFMKSPRRREETEKNTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0066655_110607232 | 3300018431 | Grasslands Soil | MKRPRRREEKEKNTANTPKTIDVDDAGRLYSLDTRVKKTP |
| Ga0066662_126272912 | 3300018468 | Grasslands Soil | MKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0066669_104042582 | 3300018482 | Grasslands Soil | MKSPRRREEKEKNTAKTPKTIDVDDAGRLYSLDTWVKKTP |
| Ga0209235_10078825 | 3300026296 | Grasslands Soil | MKRPRRREEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209469_10272643 | 3300026307 | Soil | MKSPRRREETEKNTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209469_11026182 | 3300026307 | Soil | MKSPRRREENEKNTAKTPKTMDVDDAGRSYSPDTWVKKTP |
| Ga0209055_100091914 | 3300026309 | Soil | MKRPRRREEKENSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209055_10206853 | 3300026309 | Soil | LPGPFLFMKRPRSREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209268_10106836 | 3300026314 | Soil | PPRRMVLPGPFLFMKSPRRREENEKNTAKTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209686_10754942 | 3300026315 | Soil | MKRPRSREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209155_10041676 | 3300026316 | Soil | MRRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209154_100021217 | 3300026317 | Soil | LPGPFLFMKRPRRREEKENSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209154_10089673 | 3300026317 | Soil | LPGPFLFMKRPRRMEEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209470_100174611 | 3300026324 | Soil | MKRPRKREEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209152_100002886 | 3300026325 | Soil | LPGPFLFMKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209802_10113313 | 3300026328 | Soil | MKRPRRMEEKENSTAKTPKTMDVAEAGRLYSLDTRVKKTP |
| Ga0209375_10551173 | 3300026329 | Soil | MKSPRRREENEKNMAKTPKTMDVDEAGRLYSPDTWVKKTP |
| Ga0209375_11138301 | 3300026329 | Soil | RRSEEKEKSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209473_10622022 | 3300026330 | Soil | LPGPFLFMKRPRRREEKEKNTANTPKTIDVDDAGRLYSLDTRVKKTP |
| Ga0209158_10424852 | 3300026333 | Soil | MKRPRRMEEKENSTAKTPKTMDVADAGRLYSLDTREKKTP |
| Ga0209804_11218513 | 3300026335 | Soil | MKRPRRREEKEKSTAKTPKTIDVADAGRLYSLDTRVKKTP |
| Ga0209057_11792641 | 3300026342 | Soil | KLPPIRMVLPGPFFFMKRPRRREEREKSTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209160_12914302 | 3300026532 | Soil | PPPSKMVFPGPFLLMKSPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKKTP |
| Ga0209058_13373562 | 3300026536 | Soil | PGPFLLMKSPRRREEKEKNTANTPKMMDVDDAGRLYSLDIRVKNTP |
| Ga0209056_100945124 | 3300026538 | Soil | MKSPRRTEEKEKNTAKTPKTMDVDDAGRLYSPDTWVKKTP |
| Ga0209056_100976352 | 3300026538 | Soil | MKRPRRREEKEKSTAKTPKTMDVADAGRLYSLDILVKKTP |
| Ga0209805_10027232 | 3300026542 | Soil | LPGPFLLIKRPRRREEKEKNTANTPKTMDVEDAGRLYSLDTRVKKTP |
| Ga0209156_103261672 | 3300026547 | Soil | KRPRRREEKEKNTANTPKTMEVDDAGRLYSLDTRVKKTP |
| Ga0209474_105460261 | 3300026550 | Soil | IKPPPRRMVLPGPFLFMKSPRRREETEKNTAKTPKTMDVADAGRLYSLDTRVKKTP |
| Ga0209577_1000157612 | 3300026552 | Soil | LPGPSLFMKRPRRREEKEKNTANTPKTMDVDDAGRLYSLDTRVKNTP |
| ⦗Top⦘ |