Basic Information | |
---|---|
Family ID | F099056 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 40 residues |
Representative Sequence | MKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSIQAP |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.96 % |
% of genes near scaffold ends (potentially truncated) | 35.92 % |
% of genes from short scaffolds (< 2000 bps) | 74.76 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.495 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil (25.243 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.990 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (80.583 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF02954 | HTH_8 | 14.56 |
PF00582 | Usp | 6.80 |
PF02518 | HATPase_c | 6.80 |
PF00072 | Response_reg | 2.91 |
PF13426 | PAS_9 | 2.91 |
PF08281 | Sigma70_r4_2 | 2.91 |
PF00005 | ABC_tran | 1.94 |
PF07690 | MFS_1 | 1.94 |
PF00165 | HTH_AraC | 1.94 |
PF13473 | Cupredoxin_1 | 0.97 |
PF02515 | CoA_transf_3 | 0.97 |
PF03466 | LysR_substrate | 0.97 |
PF00326 | Peptidase_S9 | 0.97 |
PF08402 | TOBE_2 | 0.97 |
PF04909 | Amidohydro_2 | 0.97 |
PF00075 | RNase_H | 0.97 |
PF01593 | Amino_oxidase | 0.97 |
PF00578 | AhpC-TSA | 0.97 |
PF02239 | Cytochrom_D1 | 0.97 |
PF12680 | SnoaL_2 | 0.97 |
PF14417 | MEDS | 0.97 |
PF00149 | Metallophos | 0.97 |
PF00106 | adh_short | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.50 % |
Unclassified | root | N/A | 16.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1043377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 752 | Open in IMG/M |
3300002558|JGI25385J37094_10000770 | All Organisms → cellular organisms → Bacteria | 9298 | Open in IMG/M |
3300002558|JGI25385J37094_10014087 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300002558|JGI25385J37094_10022841 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
3300002561|JGI25384J37096_10165003 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
3300002561|JGI25384J37096_10252842 | Not Available | 514 | Open in IMG/M |
3300002562|JGI25382J37095_10001378 | All Organisms → cellular organisms → Bacteria | 7321 | Open in IMG/M |
3300002562|JGI25382J37095_10040322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
3300002916|JGI25389J43894_1065433 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005166|Ga0066674_10002545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6731 | Open in IMG/M |
3300005166|Ga0066674_10231983 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300005446|Ga0066686_10005268 | All Organisms → cellular organisms → Bacteria | 6179 | Open in IMG/M |
3300005446|Ga0066686_10621770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 734 | Open in IMG/M |
3300005447|Ga0066689_10056245 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
3300005451|Ga0066681_10013377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4050 | Open in IMG/M |
3300005558|Ga0066698_10212180 | Not Available | 1327 | Open in IMG/M |
3300005574|Ga0066694_10328025 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
3300005586|Ga0066691_10162919 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300005713|Ga0066905_100225343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1421 | Open in IMG/M |
3300005713|Ga0066905_100229446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1411 | Open in IMG/M |
3300005713|Ga0066905_100836638 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 801 | Open in IMG/M |
3300005713|Ga0066905_100906418 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
3300005764|Ga0066903_108698741 | Not Available | 516 | Open in IMG/M |
3300006031|Ga0066651_10009541 | All Organisms → cellular organisms → Bacteria | 3888 | Open in IMG/M |
3300006032|Ga0066696_10984803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
3300006791|Ga0066653_10265329 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300006794|Ga0066658_10776055 | Not Available | 537 | Open in IMG/M |
3300006797|Ga0066659_10031737 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3169 | Open in IMG/M |
3300006904|Ga0075424_100394163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1476 | Open in IMG/M |
3300007255|Ga0099791_10019419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2912 | Open in IMG/M |
3300007255|Ga0099791_10250533 | Not Available | 840 | Open in IMG/M |
3300009012|Ga0066710_100001640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17059 | Open in IMG/M |
3300009012|Ga0066710_102560212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 735 | Open in IMG/M |
3300009162|Ga0075423_11087609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 851 | Open in IMG/M |
3300010046|Ga0126384_10050437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2867 | Open in IMG/M |
3300010046|Ga0126384_10159437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1746 | Open in IMG/M |
3300010046|Ga0126384_10408414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1149 | Open in IMG/M |
3300010046|Ga0126384_10506159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1042 | Open in IMG/M |
3300010047|Ga0126382_10044327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2557 | Open in IMG/M |
3300010087|Ga0127492_1031814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 761 | Open in IMG/M |
3300010102|Ga0127453_1112273 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300010112|Ga0127458_1124116 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300010114|Ga0127460_1067200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
3300010114|Ga0127460_1155489 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300010130|Ga0127493_1148827 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300010140|Ga0127456_1163845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
3300010141|Ga0127499_1197434 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
3300010301|Ga0134070_10006274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3648 | Open in IMG/M |
3300010301|Ga0134070_10328644 | Not Available | 589 | Open in IMG/M |
3300010304|Ga0134088_10262984 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300010325|Ga0134064_10037649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1444 | Open in IMG/M |
3300010329|Ga0134111_10013619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2643 | Open in IMG/M |
3300010337|Ga0134062_10031174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2101 | Open in IMG/M |
3300010360|Ga0126372_10454962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1188 | Open in IMG/M |
3300011269|Ga0137392_10578067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 933 | Open in IMG/M |
3300011271|Ga0137393_11094743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 677 | Open in IMG/M |
3300012189|Ga0137388_10180875 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
3300012198|Ga0137364_10943562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300012199|Ga0137383_10282298 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300012200|Ga0137382_11114504 | Not Available | 563 | Open in IMG/M |
3300012379|Ga0134058_1006116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 908 | Open in IMG/M |
3300012379|Ga0134058_1215441 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300012380|Ga0134047_1061602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
3300012396|Ga0134057_1262558 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 930 | Open in IMG/M |
3300012399|Ga0134061_1072352 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012401|Ga0134055_1013589 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
3300012401|Ga0134055_1125206 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300012927|Ga0137416_11604525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
3300012930|Ga0137407_10212139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1742 | Open in IMG/M |
3300012948|Ga0126375_10129434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1555 | Open in IMG/M |
3300012971|Ga0126369_12299795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 626 | Open in IMG/M |
3300012976|Ga0134076_10317471 | Not Available | 678 | Open in IMG/M |
3300012977|Ga0134087_10377963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
3300017657|Ga0134074_1366189 | Not Available | 534 | Open in IMG/M |
3300017659|Ga0134083_10013693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2769 | Open in IMG/M |
3300017659|Ga0134083_10095881 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1165 | Open in IMG/M |
3300018431|Ga0066655_10001910 | All Organisms → cellular organisms → Bacteria | 7700 | Open in IMG/M |
3300018431|Ga0066655_10005858 | All Organisms → cellular organisms → Bacteria | 5033 | Open in IMG/M |
3300018431|Ga0066655_11185247 | Not Available | 540 | Open in IMG/M |
3300018433|Ga0066667_10075976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2145 | Open in IMG/M |
3300018433|Ga0066667_11597531 | Not Available | 580 | Open in IMG/M |
3300018468|Ga0066662_10046357 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
3300018468|Ga0066662_12282715 | Not Available | 568 | Open in IMG/M |
3300018482|Ga0066669_10016227 | All Organisms → cellular organisms → Bacteria | 4005 | Open in IMG/M |
3300018482|Ga0066669_10398188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1165 | Open in IMG/M |
3300026277|Ga0209350_1066368 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1017 | Open in IMG/M |
3300026295|Ga0209234_1145574 | Not Available | 845 | Open in IMG/M |
3300026296|Ga0209235_1021003 | All Organisms → cellular organisms → Bacteria | 3487 | Open in IMG/M |
3300026296|Ga0209235_1056737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1852 | Open in IMG/M |
3300026297|Ga0209237_1057251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1916 | Open in IMG/M |
3300026310|Ga0209239_1216064 | Not Available | 675 | Open in IMG/M |
3300026331|Ga0209267_1136051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1025 | Open in IMG/M |
3300026528|Ga0209378_1004326 | All Organisms → cellular organisms → Bacteria | 9398 | Open in IMG/M |
3300026540|Ga0209376_1107762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1411 | Open in IMG/M |
3300027655|Ga0209388_1151715 | Not Available | 654 | Open in IMG/M |
3300027874|Ga0209465_10604116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300027875|Ga0209283_10190451 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300031720|Ga0307469_10468954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1095 | Open in IMG/M |
3300031820|Ga0307473_10427893 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 875 | Open in IMG/M |
3300031820|Ga0307473_10499192 | Not Available | 821 | Open in IMG/M |
3300032180|Ga0307471_100348078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1591 | Open in IMG/M |
3300032180|Ga0307471_102238125 | Not Available | 689 | Open in IMG/M |
3300032205|Ga0307472_100407580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1140 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 25.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 25.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.50% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10433772 | 3300002557 | Grasslands Soil | MKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP* |
JGI25385J37094_100007705 | 3300002558 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQAP* |
JGI25385J37094_100140872 | 3300002558 | Grasslands Soil | MKRFALATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP* |
JGI25385J37094_100228413 | 3300002558 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP* |
JGI25384J37096_101650031 | 3300002561 | Grasslands Soil | MKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP* |
JGI25384J37096_102528422 | 3300002561 | Grasslands Soil | NEGGEEMKRLTIAVMLALVAVSGIGVSWADRPDTPVTGPDAIQAP* |
JGI25382J37095_100013788 | 3300002562 | Grasslands Soil | MKRLGIAMLLVLVALSGVGAAWAFNDDPPLTGPDSIQAP* |
JGI25382J37095_100403222 | 3300002562 | Grasslands Soil | MKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP* |
JGI25389J43894_10654331 | 3300002916 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAXQAP* |
Ga0066674_100025453 | 3300005166 | Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP* |
Ga0066674_102319832 | 3300005166 | Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAIQAP* |
Ga0066686_100052685 | 3300005446 | Soil | MKRLTIAVMLALVAVSGIGVSWADRPDTPVTGPDAIQAP* |
Ga0066686_106217702 | 3300005446 | Soil | MKRFAIATLLAVLALGGVGTAWAFNDDTPLTGPDSIQAP* |
Ga0066689_100562454 | 3300005447 | Soil | PQKRFGVAMLLVLVALSGVGGAWAFNDDPPLTGPDSIQAP* |
Ga0066681_100133775 | 3300005451 | Soil | REGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP* |
Ga0066698_102121802 | 3300005558 | Soil | MKHFGIAVLLALVALSGVGAAWAFNEDPPLTGPDSIQAP* |
Ga0066694_103280252 | 3300005574 | Soil | MKRLGIALLLVLAALRGAGAAWAFNDDPPLTGPDSIQAP* |
Ga0066691_101629192 | 3300005586 | Soil | RSERGGECMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQAP* |
Ga0066905_1002253433 | 3300005713 | Tropical Forest Soil | MKRFAIVTLLALVALSGVGTAWAFNDDVPLTGPDSIQAP* |
Ga0066905_1002294462 | 3300005713 | Tropical Forest Soil | MVKKLSIALLLALVALSGVGTSWAFNDDTLLTGPDSIQAP* |
Ga0066905_1008366382 | 3300005713 | Tropical Forest Soil | MKRFALATLLALVAVSGVGTAWAFNDDIPLTGPDSVQAP* |
Ga0066905_1009064183 | 3300005713 | Tropical Forest Soil | MKRFGIALLLALVTLSGVGTASAFNDDTPLTGPDSIQAP* |
Ga0066903_1086987412 | 3300005764 | Tropical Forest Soil | MKHFTIAFLLALVAVSGVVGTASAYNDDPPISGPDSVQAP* |
Ga0066651_100095414 | 3300006031 | Soil | MKKLTIALLLALAAARGIGVSWADRPDTPVTGPDAIQAP* |
Ga0066696_109848032 | 3300006032 | Soil | RRAQQRGEEMKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP* |
Ga0066653_102653292 | 3300006791 | Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAMQAP* |
Ga0066658_107760552 | 3300006794 | Soil | MKRLGIAMPLILVALSGAGAAWAFNDDPPLTGPDSLQAP* |
Ga0066659_100317374 | 3300006797 | Soil | TIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP* |
Ga0075424_1003941632 | 3300006904 | Populus Rhizosphere | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSIQAP* |
Ga0099791_100194193 | 3300007255 | Vadose Zone Soil | MKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP* |
Ga0099791_102505331 | 3300007255 | Vadose Zone Soil | MKRFGIAMLLVLVALSGVGAAWAFNDDTPLTGPDSIQAP* |
Ga0066710_1000016407 | 3300009012 | Grasslands Soil | MKHFGIAVLLALVALSGVGAAWAFNEDPPLTGPDSIQAP |
Ga0066710_1025602121 | 3300009012 | Grasslands Soil | REGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP |
Ga0075423_110876091 | 3300009162 | Populus Rhizosphere | MKRFAIATLLAVLALGGVGTAWAFNDDTPLTGPDSIQA |
Ga0126384_100504374 | 3300010046 | Tropical Forest Soil | MKRFAIATLLVLVALGGAGTAWAFNDDTPLTGPDSIQAP* |
Ga0126384_101594373 | 3300010046 | Tropical Forest Soil | KKLSIALLLALVALSGVGTSWAFNDDTLLTGPDSIQAP* |
Ga0126384_104084141 | 3300010046 | Tropical Forest Soil | MKRFALATLLALVALSGIGTAWAFNDDIPLTGPDSVQAP* |
Ga0126384_105061593 | 3300010046 | Tropical Forest Soil | KRFAIVTLLALVALSGVGTAWAFNDDVPLTGPDSIQAP* |
Ga0126382_100443275 | 3300010047 | Tropical Forest Soil | MKRFALATLLALVALSGVGTAWAFNDDIPLTGLDSVQAP* |
Ga0127492_10318142 | 3300010087 | Grasslands Soil | ERQVRNMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP* |
Ga0127453_11122732 | 3300010102 | Grasslands Soil | MKRFGIALLLALVALGGVGTASAYNDDSPVSGPDAIQAP* |
Ga0127458_11241161 | 3300010112 | Grasslands Soil | MKRLGIALLLVLVALRGAGAALAFNDDPPLTGPDSIQAP* |
Ga0127460_10672001 | 3300010114 | Grasslands Soil | GPVASKEVERQVRNMKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP* |
Ga0127460_11554892 | 3300010114 | Grasslands Soil | ECMKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP* |
Ga0127493_11488271 | 3300010130 | Grasslands Soil | GECMKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP* |
Ga0127456_11638451 | 3300010140 | Grasslands Soil | KRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP* |
Ga0127499_11974341 | 3300010141 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAFNDDTPLTGPDS |
Ga0134070_100062744 | 3300010301 | Grasslands Soil | MKRFALATLLALVALSGVGTAWAFNDDIPLTGPDSVQAP* |
Ga0134070_103286441 | 3300010301 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQ |
Ga0134088_102629841 | 3300010304 | Grasslands Soil | MKRFGIALLLALVALSGVGTVWAYNDDTPVSGPDAIQAP* |
Ga0134064_100376492 | 3300010325 | Grasslands Soil | MKRFALATLLALVALSGVGIAWAFNDDNPLTGADSVQAP* |
Ga0134111_100136192 | 3300010329 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSRPGALTSA* |
Ga0134062_100311744 | 3300010337 | Grasslands Soil | MMKKLSIAFLLAVVALSGVCTSWAFNDDTPLTGPDSVQAP* |
Ga0126372_104549622 | 3300010360 | Tropical Forest Soil | MKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSIQAP* |
Ga0137392_105780671 | 3300011269 | Vadose Zone Soil | MKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP* |
Ga0137393_110947431 | 3300011271 | Vadose Zone Soil | ERGDEMKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP* |
Ga0137388_101808752 | 3300012189 | Vadose Zone Soil | VRERGDEMKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP* |
Ga0137364_109435623 | 3300012198 | Vadose Zone Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQ |
Ga0137383_102822984 | 3300012199 | Vadose Zone Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSVQAP* |
Ga0137382_111145042 | 3300012200 | Vadose Zone Soil | RRRKGREGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP* |
Ga0134058_10061162 | 3300012379 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAFNDDTPPTGPDSVQAP* |
Ga0134058_12154412 | 3300012379 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAYNDDTPVSGPDAIQAP* |
Ga0134047_10616021 | 3300012380 | Grasslands Soil | EMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP* |
Ga0134057_12625582 | 3300012396 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAFNDDTPLTGPDSVQAP* |
Ga0134061_10723522 | 3300012399 | Grasslands Soil | GECMKRFGIALLLALVALSGVGTVWAYNDDTPVSGPDAIQAP* |
Ga0134055_10135892 | 3300012401 | Grasslands Soil | CMKRFGIALLLALVALGGVGTASAYNDDSPVSGPDAIQAP* |
Ga0134055_11252062 | 3300012401 | Grasslands Soil | ECMKRFGIALLLALVALSGVGTVWAYNDDTPVSGPDAIQAP* |
Ga0137416_116045251 | 3300012927 | Vadose Zone Soil | MKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSVQAP* |
Ga0137407_102121394 | 3300012930 | Vadose Zone Soil | RRRRKGREGVRMMKKLRIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP* |
Ga0126375_101294342 | 3300012948 | Tropical Forest Soil | MKQLGIAVLLALVALGGVGTASAYNDDTPISGPDAIQAP* |
Ga0126369_122997952 | 3300012971 | Tropical Forest Soil | MKRFAIATLLVLVALGGVGTAWAFNDDTPLTGPDSIQAP* |
Ga0134076_103174711 | 3300012976 | Grasslands Soil | MKHFGIAMLLALVALSSVGAAWAFNEDPPLTGPDSIQAP* |
Ga0134087_103779633 | 3300012977 | Grasslands Soil | MKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAI |
Ga0134074_13661891 | 3300017657 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDS |
Ga0134083_100136933 | 3300017659 | Grasslands Soil | MKKLTIALLLALAAARGIGVSWADRPDTPVTGPDAIQAP |
Ga0134083_100958812 | 3300017659 | Grasslands Soil | MKRLTIAVMLALVAVSGIGVSWADRPDTPVTGPDAIQAP |
Ga0066655_1000191010 | 3300018431 | Grasslands Soil | MKKLTIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP |
Ga0066655_100058586 | 3300018431 | Grasslands Soil | MKRFALATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP |
Ga0066655_111852471 | 3300018431 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDSIQAP |
Ga0066667_100759764 | 3300018433 | Grasslands Soil | MKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP |
Ga0066667_115975311 | 3300018433 | Grasslands Soil | REGVRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP |
Ga0066662_100463571 | 3300018468 | Grasslands Soil | SERGGECMKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAIQAP |
Ga0066662_122827152 | 3300018468 | Grasslands Soil | VRMMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP |
Ga0066669_100162276 | 3300018482 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAIQAP |
Ga0066669_103981881 | 3300018482 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPLTGPDSVQAP |
Ga0209350_10663682 | 3300026277 | Grasslands Soil | ARDERGDEMKRFALATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP |
Ga0209234_11455742 | 3300026295 | Grasslands Soil | VNGVIAAVLLALVALSGVGTAWAFNDDNPLTGPDSVQAP |
Ga0209235_10210036 | 3300026296 | Grasslands Soil | MKRFGIALLLALVALSGVGTASAYNDDSPVSGPDAVQAP |
Ga0209235_10567372 | 3300026296 | Grasslands Soil | MKRFGIALLLALVALSGVSTVWAYNDDTPVSGPDAIQAP |
Ga0209237_10572513 | 3300026297 | Grasslands Soil | MKRLGIAMLLVLVALSGVGAAWAFNDDPPLTGPDSIQAP |
Ga0209239_12160641 | 3300026310 | Grasslands Soil | MMKKLSIAFLLAVVALSGVGTSWAFNDDTPVTGPDS |
Ga0209267_11360513 | 3300026331 | Soil | TIALLLALVAARGIGVSWADRPDTPVTGPDAIQAP |
Ga0209378_10043261 | 3300026528 | Soil | MKKLTIALLLALAAARGIGVSWADRPDTPVTGPDAIQA |
Ga0209376_11077623 | 3300026540 | Soil | GVRTGGDEMKRLGIALLLVLVALRGAGAAWAFNDDPPLTGPDSIQAP |
Ga0209388_11517151 | 3300027655 | Vadose Zone Soil | MKRFGIAMLLVLVALSGVGAAWAFNDDTPLTGPDSIQAP |
Ga0209465_106041161 | 3300027874 | Tropical Forest Soil | FGIALLLALVALSGVGTASAFNDDTPLTGPDSIQAS |
Ga0209283_101904513 | 3300027875 | Vadose Zone Soil | MKRFGIAMLLVLVALSGVGAWAFNDDTPLTGPDSIQSP |
Ga0307469_104689542 | 3300031720 | Hardwood Forest Soil | MKKLSIALLFALVALTGIAATASAYNDDPPISGPDSVQAP |
Ga0307473_104278932 | 3300031820 | Hardwood Forest Soil | MKRFVLATLLALVALSGVGTAWAFNDDNPLTGPDSVQAP |
Ga0307473_104991922 | 3300031820 | Hardwood Forest Soil | MKKLSIALLLALVALSGVGTSWAFNDDDTPVTGPDAVQAP |
Ga0307471_1003480783 | 3300032180 | Hardwood Forest Soil | MKKFTIAFLLALVALSGVVGTASAYNDDPPISGPDSVQAP |
Ga0307471_1022381251 | 3300032180 | Hardwood Forest Soil | MKHFVLATLLVLVAFGGVGTAWAFNDDPPLTGPDS |
Ga0307472_1004075803 | 3300032205 | Hardwood Forest Soil | MKKLSIALLLALVALSGVGTSWAFNDDTPLTGPDSVQAP |
⦗Top⦘ |