| Basic Information | |
|---|---|
| Family ID | F099046 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TIDATERAAIEALFRAFEPYRYDRDAGPLRFVTLAQLAKAYSR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.97 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.029 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.155 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.864 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.340 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01434 | Peptidase_M41 | 63.11 |
| PF02355 | SecD_SecF | 8.74 |
| PF07549 | Sec_GG | 1.94 |
| PF00004 | AAA | 0.97 |
| PF13419 | HAD_2 | 0.97 |
| PF14690 | zf-ISL3 | 0.97 |
| PF03006 | HlyIII | 0.97 |
| PF13518 | HTH_28 | 0.97 |
| PF04055 | Radical_SAM | 0.97 |
| PF13683 | rve_3 | 0.97 |
| PF02272 | DHHA1 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 63.11 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 10.68 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 10.68 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.03 % |
| All Organisms | root | All Organisms | 0.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005177|Ga0066690_10051575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.88% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.88% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013427 | Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A10PFW1_116603052 | 3300001538 | Permafrost | VSHPGTIVPAERAAIEALLGAFDALRYDRDAGPVRFVTPAQLAKAYRP* |
| JGI25382J43887_101403321 | 3300002908 | Grasslands Soil | ATERAAIEALFEAFAPVRYDRDAGPVHFVTLAQLAKAYGR* |
| soilH2_102709632 | 3300003324 | Sugarcane Root And Bulk Soil | ATIDATERAAIETLFAAFEPYRWDRQHGPLRFVTLSQLAKAIGP* |
| Ga0063356_1003024651 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RAMTLVSHPSTIDATERAAIEKLFQAFEPYRLDRDKGPLRFVTLSQLAKAYGP* |
| Ga0062592_1002132132 | 3300004480 | Soil | GTIDTIERAAIEALFHAFDPYRYDRDSGPLRFVTLAQLAKAYGR* |
| Ga0066683_106312871 | 3300005172 | Soil | RAVTIVSHPSTIDATERGAIAALFSALAPLRYDLDNGPVRFVTLAQLAQAWR* |
| Ga0066680_101000601 | 3300005174 | Soil | PGTINAAEGAAINSLFDALATLRYDLDKGPLRFVTLAQLAQAWR* |
| Ga0066673_103432211 | 3300005175 | Soil | IDATERAAITALFDAFAPLRYDRDAGPVRFVTLAQLAKAWR* |
| Ga0066690_100515751 | 3300005177 | Soil | GTIDATERAAITELFDALASLRYDLDNGPLRFVTLAQLAQAWR* |
| Ga0066671_106292061 | 3300005184 | Soil | IDATERGAIEALFTAFDPYRYDRDAGPLRFVTAAELAQAYR* |
| Ga0066676_102581052 | 3300005186 | Soil | TIDATERAAIEALFRAFEPYRYDRDAGPLRFVTLAQLAKAYSR* |
| Ga0066676_106422031 | 3300005186 | Soil | RRAITIVSHPGTIDATERAAITALFEALTPLRYDQDKGPVRFVTLAQLAQAWP* |
| Ga0066675_111982281 | 3300005187 | Soil | IDASERAAIEALLGAFAPLRYDRDTGPLRFVTLAQLAKAYGL* |
| Ga0065715_101582342 | 3300005293 | Miscanthus Rhizosphere | IDTIERAAIEALFHAFDPYRYDRDAGPLRFVTLAQLAKAYGR* |
| Ga0070691_106202071 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | TERAAIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYRP* |
| Ga0066686_104734761 | 3300005446 | Soil | RAITIVSHPGTIDATECAAITALFNAFAPLRYDLDNGPVRFVTLAQLAQAWR* |
| Ga0070706_1003225741 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TIDATERAAIEALFDAFGPLRYDADRGPVRFVTLAELAEAWR* |
| Ga0070706_1003317551 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GTIDATERAAIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYSR* |
| Ga0070697_1006787091 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SHPATIDAIERDAIESLFTAFAPLRYDADAGPVRFVTLAQLAQALK* |
| Ga0070697_1019991632 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSHPGTITATERAAIEALFQAFEPVRYDRDAGPVRFVTLAQLAKAYGR* |
| Ga0066704_101393062 | 3300005557 | Soil | NERAAITALFDAFTPLRYDLDNGPLRFVTLAQLAQAWR* |
| Ga0066700_102811452 | 3300005559 | Soil | ITIVSHPGTIDATERAAITALFDALAALRYDQDKGPVRFVTLAQLAQAWP* |
| Ga0066699_102142843 | 3300005561 | Soil | SHPGTIGPAERAAIEALLGAFGPLRYDADAGPVRFVTLAQLATAWGR* |
| Ga0066699_103663561 | 3300005561 | Soil | AIETLFAAFEPLRYDRGNGPLRFVTLAQLATAYSR* |
| Ga0066703_102236181 | 3300005568 | Soil | ERAAIESLFAAFAPLRYDRDIGPVRFVTLAQLARAYG* |
| Ga0066691_104009602 | 3300005586 | Soil | ERAAIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYAR* |
| Ga0066706_100985801 | 3300005598 | Soil | TIDATERAAITELFDALASLRYDLDNGPLRFVTLAQLAQAWR* |
| Ga0066706_102337202 | 3300005598 | Soil | TIDATERAAITELFDALASLRYDLDNGPLRFITLAQLAQAYPY* |
| Ga0066706_114399371 | 3300005598 | Soil | TIVASERAAIETLFAAFEPLRYDRGNGPLRFVTLAQLAEAYSR* |
| Ga0068870_105170651 | 3300005840 | Miscanthus Rhizosphere | PATVNATERAAIESLFRSFEPYRYDRDGGPLRFVTLAQLAQAFK* |
| Ga0066653_105969141 | 3300006791 | Soil | AAIEALFLAFDPVRYDRDAGPVRFVTLAQLAKAYGR* |
| Ga0066659_101176461 | 3300006797 | Soil | TLVSHPGTIVPAERAAIESLFSAFAPLRYDRDAGPVRFITLAQLATAYGP* |
| Ga0075425_1003102882 | 3300006854 | Populus Rhizosphere | ERGAIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYSR* |
| Ga0079215_104134661 | 3300006894 | Agricultural Soil | IEKLFQAFEPYRWDRDKGPLRFVTLSQLAKAYGP* |
| Ga0075424_1023602081 | 3300006904 | Populus Rhizosphere | GTIDATERAAIETLFKAFFPLRYDQDSGPLRFVTLAQLAAAYSR* |
| Ga0079216_115837071 | 3300006918 | Agricultural Soil | HPSTIDATERAAIEKLFQAFEPYRWDRDKGPLRFVTLSQLAKAYGP* |
| Ga0079218_108255502 | 3300007004 | Agricultural Soil | EKLFQAFEPYRWDRDKGPLRYVTLSQLAKAYSSP* |
| Ga0066710_1001236695 | 3300009012 | Grasslands Soil | ERAAIEALVKAFAPLRYDRDVGPLRFVTLAEVAKAYSK |
| Ga0066710_1006498501 | 3300009012 | Grasslands Soil | IVSHPGTIDATERAAIETLLGAFAPVRYDRDTGPLRFVTLAQLAKAYGL |
| Ga0066710_1012889213 | 3300009012 | Grasslands Soil | GAIEALLGAVGPLRYDADAGPVRFVTLAQLATAWAR |
| Ga0099827_118890632 | 3300009090 | Vadose Zone Soil | IVSHPGTLDATEPAAITALFEALAPLRYDLDRGPVRFVTLAQLAQAWR* |
| Ga0066709_1022066862 | 3300009137 | Grasslands Soil | DATERDAIEALFRAFEAYRYDRDAGALRFVTLAQLAKAYAR* |
| Ga0105164_101217611 | 3300009777 | Wastewater | PGTIDAAERAAIETLLHAFDPFRYDQDRGPVRSITLRELAQVWK* |
| Ga0134088_102730402 | 3300010304 | Grasslands Soil | IEALFRAFEPYRYDRDAGPLRFVTLAQLAKAYSR* |
| Ga0134111_102294031 | 3300010329 | Grasslands Soil | SHPGTIDATERAAITELFDALASLRYDLDNGPLRFITLAQLAQAYPY* |
| Ga0134126_130995412 | 3300010396 | Terrestrial Soil | RAAITALFDALAPLRYDRDAGPVRFVTLAQLAQAWR* |
| Ga0134124_127090721 | 3300010397 | Terrestrial Soil | TLVSHPATIDATERAAIEKLFAAFEPYRWDRDMGPLRYVTLAQLAKAFGP* |
| Ga0120163_10859061 | 3300012003 | Permafrost | PGTIDATERAAIAALFNALAPLRYDRDAGPVRFVTLAQLAQAWR* |
| Ga0137399_105607192 | 3300012203 | Vadose Zone Soil | IDVTERAAITALFEALAPLRYDQDKGPLRFVTLAQLAQAWR* |
| Ga0137399_109839011 | 3300012203 | Vadose Zone Soil | AIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYAR* |
| Ga0137380_113324472 | 3300012206 | Vadose Zone Soil | TVVSHPGTNDATERAAIEALFRAFEPYRYDRDAGPLRFVTLAQLAKAYSR* |
| Ga0137381_107552762 | 3300012207 | Vadose Zone Soil | VSHPGTIDATERAAITAIFNALAPFRYDLDQGPLRFVTLAQLAQAWR* |
| Ga0137376_103171501 | 3300012208 | Vadose Zone Soil | IDATERAAITALFDAFAPLRYDRDAGPVRFVTLAQLAQAWR* |
| Ga0137377_100238871 | 3300012211 | Vadose Zone Soil | HPGTIDATERAATEALFRAFEPYRYDRDAGPLRFVTLAQLAKAYSR* |
| Ga0137377_106412772 | 3300012211 | Vadose Zone Soil | HPGTIDATERAAITALFEALAPLRYDQDKGPLRFVTLAQLAQAWP* |
| Ga0137367_101564851 | 3300012353 | Vadose Zone Soil | ALTLVSHPGTIDATERAAIEALLGAFTPYRYDSDAGPLRFVTLAQLAKAYSR* |
| Ga0137367_107468521 | 3300012353 | Vadose Zone Soil | TIDATERAAIETLFRAFEPLRYERDTGPLRFVTLAQLAKAYSP* |
| Ga0137368_100881693 | 3300012358 | Vadose Zone Soil | TIDATERGAIEKLFAAFEPYRWDRDMGPLRYVTLAQLAKAYGP* |
| Ga0137397_100497301 | 3300012685 | Vadose Zone Soil | RAAIEALFKAFGPLRYDADSGPVRFVTLAQVAQAFR* |
| Ga0137396_104046541 | 3300012918 | Vadose Zone Soil | IDATERAAIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYAR* |
| Ga0137410_103743431 | 3300012944 | Vadose Zone Soil | EVKVARDATERAAITALFNALAPLRYDLDKGPVRFVTLAQLAQAWR* |
| Ga0120106_10260463 | 3300013427 | Permafrost | AIEALLGAFDPLRYDLDSGPVRFVTLAQLAKAYGP* |
| Ga0120158_102850281 | 3300013772 | Permafrost | IEALLGAFDALRYDKDSGPVRFVTAAQLAKAYRQ* |
| Ga0134075_100132982 | 3300014154 | Grasslands Soil | VSHPGTIDATERAAIAALFNALAPLRYDRDSGPLRFVTLAQLAQAWR* |
| Ga0167657_10343822 | 3300015079 | Glacier Forefield Soil | GTIDATERAAIESLFQSFEPYRYDRDHGPVRFVTLAQLAQALK* |
| Ga0167650_11111581 | 3300015203 | Glacier Forefield Soil | TIVPAERAAIEALLGAFDGLRYDKDAGPVRFVTAAQLAKAYRQ* |
| Ga0137409_100429411 | 3300015245 | Vadose Zone Soil | GTIDATERAAITALFNALAPLRYDLDKGPVRFVTLAQLAQAWR* |
| Ga0132258_131184931 | 3300015371 | Arabidopsis Rhizosphere | LTLVSHPATIDPIERDAIESLFKAFGPLRYEADSGPLRFVTLAQLAQAMK* |
| Ga0134112_103917251 | 3300017656 | Grasslands Soil | RAITLVSHPGTIDDTERVAIESLFAAFEPLRYDRDEGPLRFVTLAQLARAYAP |
| Ga0184610_10675301 | 3300017997 | Groundwater Sediment | ERAAIEKLFQAFEPYRWDRDKGPLRFVTLSQLAKAYNR |
| Ga0184604_103734222 | 3300018000 | Groundwater Sediment | TESAAIAALFNALGPLRYDRDSGPVRFVTLAQLAQAWR |
| Ga0184632_101861952 | 3300018075 | Groundwater Sediment | VSHPSTIDATERGAIETLFRAFDQYRYDRDAGPLRFVTLAQLARAYGP |
| Ga0215015_104605542 | 3300021046 | Soil | SHPGTFDATERAAIEALFTAFAPLRYDDDAGPVRFVTLTQFAAAYK |
| Ga0222625_16450601 | 3300022195 | Groundwater Sediment | APLALTIVSHPGTIDATERAAITALFNAFAPLRYDLDKGPVRFVTLAQLAQAWR |
| Ga0137417_13529882 | 3300024330 | Vadose Zone Soil | VITVVSHPGTIVPAERAAIEALLGAFGPLRYDADAGPVRFVTLAQLAKAYNR |
| Ga0209642_102485483 | 3300025167 | Soil | GAIEALFRAFDPFRYDRDAGPLRFVTLAQLAKAYAR |
| Ga0209824_100561721 | 3300025173 | Wastewater | PGTIDATERAAIESLFRALEPYRFDRDRGPVRFITLAQLGKALK |
| Ga0209824_102181872 | 3300025173 | Wastewater | IVSHPGTIDAAERAAIETLLHAFDPFRYDQDKGPLRFVTLQQLARAWK |
| Ga0207699_108576413 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PAERAAIEALLMAFGPLRYDTDSGPVRFVTLAQLAKAYAH |
| Ga0207670_108575732 | 3300025936 | Switchgrass Rhizosphere | TERAAIEALFKSFEPYRYDRDNGPLRFVTLAQLAQAFK |
| Ga0207704_103110862 | 3300025938 | Miscanthus Rhizosphere | VSHPGTIDTIERAAIEALFHAFDPYRYDRDSGPLRFVTLAQLAKAYGR |
| Ga0209238_12731822 | 3300026301 | Grasslands Soil | TIDATERAAITALFEALAPLRYDQDKGPLRFVTLAQLAQAWR |
| Ga0209471_11538641 | 3300026318 | Soil | VPAERAAIESLFSAFAPLRYDRDAGPVRFITLAQLATAYGP |
| Ga0209473_10559941 | 3300026330 | Soil | GPAERAAVEALLGAFGPLRYDADAGPVRFVTLAQLATAWGR |
| Ga0209803_11020391 | 3300026332 | Soil | ATERAAIESLFAAFAPLRYDRDIGPVRFVTLAQLARAYG |
| Ga0209160_11402181 | 3300026532 | Soil | VSHPGTIDANERAAITALFDAFRPLRYDLDNGPLRFVTLAQLAQAWR |
| Ga0209157_10794521 | 3300026537 | Soil | RAAIESLFAAFAPLRYDRDIGPVRFVTLAQLARAYG |
| Ga0209056_100437255 | 3300026538 | Soil | AITIVSHPGTIDATERAAITALFEALAPLRYDQDKGPVRFVTLAQLAQAWP |
| Ga0209056_101199313 | 3300026538 | Soil | DATERAAIEALFRAFEPYRYDRDAGPLRFITLAQLAKAYSR |
| Ga0209376_11008371 | 3300026540 | Soil | VVSHPGTIDATERAAIEALFRAFEPYRYDRDAGPLRFITLAQLAKAYSR |
| Ga0209161_101112902 | 3300026548 | Soil | SHPGTIDATERAAITALFEALAPLRYDQDKGPVRFVTLAQLAQAWP |
| Ga0209474_100482175 | 3300026550 | Soil | VSHPGTIVPAERAAIESLFSAFAPLRYDRDAGPVRFITLAQLATAYGP |
| Ga0209011_11018731 | 3300027678 | Forest Soil | DATERAAIEALFRAFDPYRYDRDAGPLRFVTLAQLAKAYAR |
| Ga0209590_103324012 | 3300027882 | Vadose Zone Soil | ITATERAAIEALFQAFDPVRYDRDAGPVHFVTLAQLAKAYGR |
| Ga0209590_106005912 | 3300027882 | Vadose Zone Soil | HPGTIDATERAAITALFDAFSPLRYDRHAGPVRFVTLAQLAQAWR |
| Ga0307301_101215621 | 3300028719 | Soil | IDATERAVITALFNAFAPLRHDLDNGPVRFVTLAQLAQAWR |
| Ga0307305_100457771 | 3300028807 | Soil | AAITALFEAFAPLRYDRDAGPVRFVTLAQLAQAWR |
| Ga0307292_100951431 | 3300028811 | Soil | AIEALFRAFEPYRYDRDAGPLRFVTLAQLAKAYSR |
| Ga0307304_102203811 | 3300028885 | Soil | HPGTIDATERAAIEALFQSFEPYRYDRDNGPLRFVTLAQLERAFK |
| Ga0307473_106594772 | 3300031820 | Hardwood Forest Soil | IDATERAAITALFDAFAPLRYDQDNGPLRFVTLAQLADAWR |
| Ga0326597_104957451 | 3300031965 | Soil | STIGATERGAIETLFRAFEPLRYDRDAGPLRFVTLAQLAKAYAR |
| Ga0307471_1026125471 | 3300032180 | Hardwood Forest Soil | TVVSHPGTIDATERAAIESLFAALEPLRYDRDSGPVRFVTLAQLARAYAR |
| Ga0364934_0425100_357_503 | 3300034178 | Sediment | VSHPSTIDATERGAIETLFRAFDPYRYDRDAGPLRFVTLAQLAKAYSR |
| ⦗Top⦘ |