Basic Information | |
---|---|
Family ID | F099012 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | GMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.88 % |
% of genes near scaffold ends (potentially truncated) | 96.12 % |
% of genes from short scaffolds (< 2000 bps) | 68.93 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.262 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (30.097 % of family members) |
Environment Ontology (ENVO) | Unclassified (69.903 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (72.816 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF13487 | HD_5 | 18.45 |
PF01966 | HD | 17.48 |
PF13424 | TPR_12 | 7.77 |
PF13191 | AAA_16 | 4.85 |
PF00072 | Response_reg | 0.97 |
PF00682 | HMGL-like | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.26 % |
Unclassified | root | N/A | 8.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002561|JGI25384J37096_10036601 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
3300005172|Ga0066683_10617482 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005174|Ga0066680_10022682 | All Organisms → cellular organisms → Bacteria | 3454 | Open in IMG/M |
3300005174|Ga0066680_10191351 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300005174|Ga0066680_10219770 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300005175|Ga0066673_10101431 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300005178|Ga0066688_10179978 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300005180|Ga0066685_10690996 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005186|Ga0066676_10070816 | Not Available | 2044 | Open in IMG/M |
3300005446|Ga0066686_10096260 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
3300005540|Ga0066697_10039949 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
3300005545|Ga0070695_100028971 | All Organisms → cellular organisms → Bacteria | 3438 | Open in IMG/M |
3300005552|Ga0066701_10334587 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005555|Ga0066692_10006473 | All Organisms → cellular organisms → Bacteria | 5260 | Open in IMG/M |
3300005558|Ga0066698_10987092 | Not Available | 535 | Open in IMG/M |
3300005559|Ga0066700_11014241 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005560|Ga0066670_10029009 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
3300005566|Ga0066693_10015709 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300005575|Ga0066702_10197431 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300006046|Ga0066652_100441199 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300006796|Ga0066665_10260078 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300006800|Ga0066660_10224303 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300007076|Ga0075435_100033181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 4080 | Open in IMG/M |
3300009012|Ga0066710_100131297 | All Organisms → cellular organisms → Bacteria | 3439 | Open in IMG/M |
3300009089|Ga0099828_10172417 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
3300009089|Ga0099828_10799830 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300010095|Ga0127475_1032421 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300010104|Ga0127446_1099881 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300010108|Ga0127474_1017705 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300010119|Ga0127452_1166639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
3300010125|Ga0127443_1132319 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010126|Ga0127482_1018048 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300010301|Ga0134070_10180339 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300010303|Ga0134082_10010440 | All Organisms → cellular organisms → Bacteria | 3349 | Open in IMG/M |
3300010304|Ga0134088_10091783 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300010333|Ga0134080_10062239 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300010333|Ga0134080_10261983 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300010336|Ga0134071_10130312 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300010396|Ga0134126_10160407 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
3300012096|Ga0137389_10186078 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300012198|Ga0137364_10586295 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300012203|Ga0137399_10032624 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
3300012205|Ga0137362_10017371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5459 | Open in IMG/M |
3300012206|Ga0137380_10343426 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300012209|Ga0137379_10068386 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
3300012209|Ga0137379_10541763 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300012209|Ga0137379_11000201 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300012211|Ga0137377_10062560 | All Organisms → cellular organisms → Bacteria | 3469 | Open in IMG/M |
3300012285|Ga0137370_10051654 | Not Available | 2206 | Open in IMG/M |
3300012349|Ga0137387_10149650 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300012351|Ga0137386_10212001 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300012356|Ga0137371_10044606 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
3300012359|Ga0137385_10424576 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300012375|Ga0134034_1030930 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300012379|Ga0134058_1015269 | Not Available | 729 | Open in IMG/M |
3300012379|Ga0134058_1229786 | All Organisms → cellular organisms → Bacteria | 2978 | Open in IMG/M |
3300012390|Ga0134054_1140931 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012392|Ga0134043_1021729 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012397|Ga0134056_1099537 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300012398|Ga0134051_1159443 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012399|Ga0134061_1006750 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012404|Ga0134024_1263613 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300012405|Ga0134041_1250106 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012405|Ga0134041_1337394 | Not Available | 1619 | Open in IMG/M |
3300012405|Ga0134041_1420457 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300012683|Ga0137398_10077295 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
3300012683|Ga0137398_10293016 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300012931|Ga0153915_10563885 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300012976|Ga0134076_10488458 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300014150|Ga0134081_10001531 | All Organisms → cellular organisms → Bacteria | 5500 | Open in IMG/M |
3300014150|Ga0134081_10045571 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300014157|Ga0134078_10136439 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300014157|Ga0134078_10214703 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 791 | Open in IMG/M |
3300015052|Ga0137411_1339479 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300015357|Ga0134072_10101794 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300015359|Ga0134085_10219556 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300018431|Ga0066655_10014948 | All Organisms → cellular organisms → Bacteria | 3478 | Open in IMG/M |
3300018433|Ga0066667_11277578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 641 | Open in IMG/M |
3300018482|Ga0066669_10090586 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
3300020004|Ga0193755_1035726 | Not Available | 1639 | Open in IMG/M |
3300024330|Ga0137417_1341372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2866 | Open in IMG/M |
3300025922|Ga0207646_10106991 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
3300026277|Ga0209350_1034400 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300026296|Ga0209235_1021321 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
3300026297|Ga0209237_1227335 | Not Available | 578 | Open in IMG/M |
3300026298|Ga0209236_1080451 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300026305|Ga0209688_1045522 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300026313|Ga0209761_1012514 | All Organisms → cellular organisms → Bacteria | 5493 | Open in IMG/M |
3300026313|Ga0209761_1024372 | All Organisms → cellular organisms → Bacteria | 3724 | Open in IMG/M |
3300026322|Ga0209687_1120703 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300026324|Ga0209470_1102416 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300026332|Ga0209803_1022207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3110 | Open in IMG/M |
3300026334|Ga0209377_1064161 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300026335|Ga0209804_1010018 | All Organisms → cellular organisms → Bacteria | 5160 | Open in IMG/M |
3300026335|Ga0209804_1021336 | All Organisms → cellular organisms → Bacteria | 3370 | Open in IMG/M |
3300026343|Ga0209159_1090167 | Not Available | 1356 | Open in IMG/M |
3300026524|Ga0209690_1110791 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300027655|Ga0209388_1003748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3802 | Open in IMG/M |
3300027748|Ga0209689_1038511 | All Organisms → cellular organisms → Bacteria | 2771 | Open in IMG/M |
3300027748|Ga0209689_1078287 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
3300027765|Ga0209073_10505781 | Not Available | 510 | Open in IMG/M |
3300027875|Ga0209283_10623230 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300031231|Ga0170824_109826288 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 30.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 29.13% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.36% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25384J37096_100366012 | 3300002561 | Grasslands Soil | IIVVTGGMPQAATAQLKDMGVKVIVNKSEGMPAVVDAMRQALQRRKVA* |
Ga0066683_106174821 | 3300005172 | Soil | GGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0066680_100226823 | 3300005174 | Soil | VTGGMPEAASAQLRGMGVKVIVNKTDGMPAVVEAMRQALKRRKAA* |
Ga0066680_101913512 | 3300005174 | Soil | EAASAQLRQMGVKVIVNKGDGMPAVVDAMRQALQRRKAA* |
Ga0066680_102197701 | 3300005174 | Soil | RKLDSEIIVVTGGIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0066673_101014311 | 3300005175 | Soil | IPEAASAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0066688_101799782 | 3300005178 | Soil | VTGGIPEAASSQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0066685_106909962 | 3300005180 | Soil | PEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0066676_100708161 | 3300005186 | Soil | EAASAQLRQMGVQTIVSKTDGMPGVVEAMRQALKRRKAA* |
Ga0066686_100962602 | 3300005446 | Soil | TGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0066697_100399491 | 3300005540 | Soil | RKLDAEIIVVTGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0070695_1000289711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VIVVTGGMPDEAAVELRRMGVKVILNKSAGMPAVVDAMREALRRRKAA* |
Ga0066701_103345871 | 3300005552 | Soil | VTGGIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0066692_100064731 | 3300005555 | Soil | AVELREMGVKTIVNKVEGMQAVVEAMQLALKRRKVA* |
Ga0066698_109870921 | 3300005558 | Soil | DQAAVALRQMGVKVILNKAAGMPAVVEAMGEALRRRKAA* |
Ga0066700_110142411 | 3300005559 | Soil | AASAQLKSMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0066670_100290093 | 3300005560 | Soil | SAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0066693_100157091 | 3300005566 | Soil | AQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0066702_101974312 | 3300005575 | Soil | VVTGGMPEQAAVELRQMGVKVILNKSAGMPAVVDAMREALRRRKAA* |
Ga0066652_1004411991 | 3300006046 | Soil | EIIVVTGGIPEAASAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0066665_102600783 | 3300006796 | Soil | RPEAAGAQRRQMGVKVIVNKADGMPGVVDAMRQALKRRKAA* |
Ga0066660_102243032 | 3300006800 | Soil | VIVVTGGMPEKAAVELREMGVKTIVNKVAGMQAVVEAMQQALKRRKVA* |
Ga0075435_1000331813 | 3300007076 | Populus Rhizosphere | VQLRQMGVKMILNKAEGMPAVVDAMREALRRRKAA* |
Ga0066710_1001312973 | 3300009012 | Grasslands Soil | GMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA |
Ga0099828_101724171 | 3300009089 | Vadose Zone Soil | QATGELRRMGVKVILNKSEGMPAVVDAMREALRRRKAA* |
Ga0099828_107998302 | 3300009089 | Vadose Zone Soil | MPEQATGELRRMGVKVILNKSEGMPAVVDAMREALRRRKAA* |
Ga0127475_10324211 | 3300010095 | Grasslands Soil | AASAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0127446_10998812 | 3300010104 | Grasslands Soil | AASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0127474_10177052 | 3300010108 | Grasslands Soil | GMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0127452_11666391 | 3300010119 | Grasslands Soil | GIPEMATKQLKDMGVKVIVNKSEGMPAVMEAVQEALRKRKVA* |
Ga0127443_11323191 | 3300010125 | Grasslands Soil | PETAAVELREMGVKTIVNKVDGMQAVVEAMQQALKRRKVA* |
Ga0127482_10180481 | 3300010126 | Grasslands Soil | AEVIVVTGGMPEAAAAQLRQMGVKVIVNKADGMPGVVDAMRQALKRRKAA* |
Ga0134070_101803391 | 3300010301 | Grasslands Soil | AASLRKLGVKTIVNKADGIAAVVEALRQALQRRKAA* |
Ga0134082_100104401 | 3300010303 | Grasslands Soil | GIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0134088_100917831 | 3300010304 | Grasslands Soil | AVLRRFGVKVILNKAEGMPAVVEALGTALKRQRGKAA* |
Ga0134080_100622392 | 3300010333 | Grasslands Soil | MVVTGGMPAEAAVELRQMGVKVILNKSEGMPAVVDAMREALRRRKAA* |
Ga0134080_102619833 | 3300010333 | Grasslands Soil | SAQLRQMGVQTIVSKTDGMPGVVEAMRQALKRRKAA* |
Ga0134071_101303122 | 3300010336 | Grasslands Soil | GMPPEAAVQLRQMGVKVILNKSEGMPAVVDAMREALRRRKAA* |
Ga0134126_101604073 | 3300010396 | Terrestrial Soil | LDADVIVVTGGMPDEAAVELRRMGVKVILNKSAGMPAVVDAMREALRRRKAA* |
Ga0137389_101860781 | 3300012096 | Vadose Zone Soil | ATGELRRMGVKVILNKSEGMPAVVDAMREALRRRQAA* |
Ga0137364_105862952 | 3300012198 | Vadose Zone Soil | ASAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0137399_100326241 | 3300012203 | Vadose Zone Soil | PEAASAQLKGMGVKVIVSKAEGMPAVVDAMRQALQRRKVA* |
Ga0137362_100173711 | 3300012205 | Vadose Zone Soil | AAGELRRMGVQVILNTSEGMPAVVDAMREALRRRKAA* |
Ga0137380_103434261 | 3300012206 | Vadose Zone Soil | PEAASAQLRGMGVKVIVNKADGMPALVDAMRQALKRRKAA* |
Ga0137379_100683861 | 3300012209 | Vadose Zone Soil | AMAELRRVGVKVVVNKAEGMPAVVDAMRQALQRRKAA* |
Ga0137379_105417631 | 3300012209 | Vadose Zone Soil | SSQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0137379_110002012 | 3300012209 | Vadose Zone Soil | ELRRVGVKVVVNKAEGMPAVVDAMRQALQRRKAA* |
Ga0137377_100625601 | 3300012211 | Vadose Zone Soil | RKLDSEIIVVTGGIPEAASSQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0137370_100516543 | 3300012285 | Vadose Zone Soil | ALRQMGVKVILNKSAGMPAVVDAMREALRRRKAA* |
Ga0137387_101496502 | 3300012349 | Vadose Zone Soil | AEIIVVTGGMPQAATAQLKDMGVKVIVNKSAGMPAVVDAMRQALQRRKVA* |
Ga0137386_102120011 | 3300012351 | Vadose Zone Soil | LDSEIIVVTGGIPEAASSQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0137371_100446061 | 3300012356 | Vadose Zone Soil | EAASSQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0137385_104245762 | 3300012359 | Vadose Zone Soil | GRKLDAEIIVVTGGMPQTATAQLKDMGVKVIVNKSEGMPAVVDAMRQALQRRKVA* |
Ga0134034_10309302 | 3300012375 | Grasslands Soil | AQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134058_10152692 | 3300012379 | Grasslands Soil | LDAEVLVVTGGMPEAAGNELREMGVKVILSKAEEMPAVVEAMRQALQRRKAA* |
Ga0134058_12297861 | 3300012379 | Grasslands Soil | EIIVVTGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134054_11409312 | 3300012390 | Grasslands Soil | MPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134043_10217291 | 3300012392 | Grasslands Soil | AQLKDMGVKVIVNKSEGMPAVVDAMRQALQRRKVA* |
Ga0134056_10995372 | 3300012397 | Grasslands Soil | RKLDAEIIVVTGGMPQAATAQLKDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134051_11594431 | 3300012398 | Grasslands Soil | QLAVTGGIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0134061_10067501 | 3300012399 | Grasslands Soil | IIVVTGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134024_12636132 | 3300012404 | Grasslands Soil | GIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQAFQKRKVA* |
Ga0134041_12501062 | 3300012405 | Grasslands Soil | LDSEIIVVTGGIPEAASAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0134041_13373942 | 3300012405 | Grasslands Soil | VELREMGVKTIVNKVEGMQAVVEAMQQALKRRKVA* |
Ga0134041_14204572 | 3300012405 | Grasslands Soil | VVTGGIPEAASAQLRDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0137398_100772953 | 3300012683 | Vadose Zone Soil | DAEVIVVTGGMPEQAAGELRRMGVKVILNKSEGMPAVVDAMREALRRRKAA* |
Ga0137398_102930162 | 3300012683 | Vadose Zone Soil | GELRRMGVKVILNKSEGMPAVVDAMREALRRRKAA* |
Ga0153915_105638852 | 3300012931 | Freshwater Wetlands | DAEVIVVTGGMPEAAAVALRQMGVKVIVNKIDGMQAVVEAMRQALQRRQQAA* |
Ga0134076_104884581 | 3300012976 | Grasslands Soil | LDSEIIVVTGGIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA* |
Ga0134081_100015311 | 3300014150 | Grasslands Soil | AEIIVVTGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134081_100455711 | 3300014150 | Grasslands Soil | IIVVTGGIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA* |
Ga0134078_101364392 | 3300014157 | Grasslands Soil | GMPERAAVELREMGVKTIVNKVEGMQAVVEAMQQALKRRKVA* |
Ga0134078_102147031 | 3300014157 | Grasslands Soil | LDAEVMVVTGGMPAEAAVELRQMGVKVILNKSEGMPAVVEAMREALRRRKAA* |
Ga0137411_13394793 | 3300015052 | Vadose Zone Soil | MPDEAAVELRRMGVKVILNKSAGMPAVVDAMREALRRRKAA* |
Ga0134072_101017942 | 3300015357 | Grasslands Soil | MEVTGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA* |
Ga0134085_102195562 | 3300015359 | Grasslands Soil | GGMPAEAAVELRQMGVKVILNKSEGMAAVVEAMREALRRRKAA* |
Ga0066655_100149483 | 3300018431 | Grasslands Soil | GRKLDAEIIVVTGGMPQAATAQLRDMGVKVIVNKSEGMPAVVEAMRQALKRRKVA |
Ga0066667_112775782 | 3300018433 | Grasslands Soil | VVGGGVPETATKQLKAMGVKVIVNKSEGMPAVMEAVQEALRRRKVA |
Ga0066669_100905862 | 3300018482 | Grasslands Soil | AEVIVVTGGMPERAAVELREMGVKTIVNKVEGMQAGVEAMQQALKRRKVA |
Ga0193755_10357261 | 3300020004 | Soil | AEVMVVTGGMPEDAAVELRRMGVKVILNKSAGMPAVVDAMRDALRRRKAA |
Ga0137417_13413722 | 3300024330 | Vadose Zone Soil | MPDEAAVELRRMGVKVILNKSAGMPAVVDAMREALRRRKAA |
Ga0207646_101069911 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGGMPEAVAVELRQMGVKTIVNKAEGMQSVVEAMQQALKRRKVA |
Ga0209350_10344001 | 3300026277 | Grasslands Soil | DSEIIVVTGGIPEAASTQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA |
Ga0209235_10213213 | 3300026296 | Grasslands Soil | MPQAATAQLKDMGVKVIVNKSEGMPAVVDAMRQALQRRKVA |
Ga0209237_12273351 | 3300026297 | Grasslands Soil | MPEQAAGELRQMGVKVILNKSAGMPAVVEAMREALRRRKAA |
Ga0209236_10804511 | 3300026298 | Grasslands Soil | IPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA |
Ga0209688_10455221 | 3300026305 | Soil | GMPERAAVELREMGVKTIVNKVEGMQAVVEAMQQALKRRKVA |
Ga0209761_10125141 | 3300026313 | Grasslands Soil | TKQLKDMGVKVIVNKSEGMPAVMEAVQEALRRRKVA |
Ga0209761_10243723 | 3300026313 | Grasslands Soil | GMPEAASAQLRGMGVKVIVNKADGMPALVDAMRQALKRRKAA |
Ga0209687_11207032 | 3300026322 | Soil | IVVTGGMPERAAVELREMGVKTIVNKVEGMQAVVDAMQQALKRRKVA |
Ga0209470_11024161 | 3300026324 | Soil | EAASAQLRQMGVQTIVSKTDGMPGVVEAMRQALKRRKAA |
Ga0209803_10222073 | 3300026332 | Soil | PAEAGVQLRQMGVKVILNKSEGMPAVVEAMREALRRRKAA |
Ga0209377_10641612 | 3300026334 | Soil | MPEAASAQLRQMGVKVIVNKGDGMPAVVDAMRQALQRRKAA |
Ga0209804_10100181 | 3300026335 | Soil | EVMVVTGGMPAEAAVQLRQMGVKVILNKSEGMPAVVDAMREALRRRKAA |
Ga0209804_10213361 | 3300026335 | Soil | IPEAASTQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA |
Ga0209159_10901671 | 3300026343 | Soil | AQLRQMGVQTIVSKTDGMPGVVEAMRQALKRRKAA |
Ga0209690_11107912 | 3300026524 | Soil | VTGGIPEAASAQLKDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA |
Ga0209388_10037483 | 3300027655 | Vadose Zone Soil | VTGGMPEKATGELRRMGVKVILNKSEGMPAVVDAMREALRRRQAA |
Ga0209689_10385113 | 3300027748 | Soil | AASSQLKDMGVKVIVSKAEGMPAVVEAMRQALQKRKVA |
Ga0209689_10782872 | 3300027748 | Soil | AASSQLKDMGVKVIVSKAEGMPAVVEAMRQALQRRKVA |
Ga0209073_105057811 | 3300027765 | Agricultural Soil | VIVVTGGMPDAAAVALRQMGVKTIVSKGEGMPAVVDAMRQALQRRKVA |
Ga0209283_106232301 | 3300027875 | Vadose Zone Soil | EQATGELRRMGVKVILNKSEGMPAVVDAMREALRRRKAA |
Ga0170824_1098262881 | 3300031231 | Forest Soil | VTGGMPEAAGKELREMGVKVILNKVEGMPAVVEAMRQALKRRKAA |
⦗Top⦘ |