Basic Information | |
---|---|
Family ID | F098984 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | EPGQPELEFWRVEASPGQGMTAGVYELRRDAATDAWTLRLGP |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.06 % |
% of genes from short scaffolds (< 2000 bps) | 93.20 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.553 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.476 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.388 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.136 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.43% Coil/Unstructured: 68.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 31.07 |
PF01471 | PG_binding_1 | 6.80 |
PF03029 | ATP_bind_1 | 2.91 |
PF00805 | Pentapeptide | 1.94 |
PF02811 | PHP | 1.94 |
PF02735 | Ku | 1.94 |
PF01370 | Epimerase | 1.94 |
PF08031 | BBE | 1.94 |
PF04978 | DUF664 | 1.94 |
PF07859 | Abhydrolase_3 | 0.97 |
PF04679 | DNA_ligase_A_C | 0.97 |
PF01636 | APH | 0.97 |
PF03633 | Glyco_hydro_65C | 0.97 |
PF14579 | HHH_6 | 0.97 |
PF00005 | ABC_tran | 0.97 |
PF00196 | GerE | 0.97 |
PF07690 | MFS_1 | 0.97 |
PF00041 | fn3 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 2.91 |
COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 2.91 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.94 |
COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.94 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.94 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.97 |
COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.97 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.55 % |
Unclassified | root | N/A | 18.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig03628 | Not Available | 909 | Open in IMG/M |
2199352025|deepsgr__Contig_123854 | Not Available | 1044 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10016284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2536 | Open in IMG/M |
3300005165|Ga0066869_10039573 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300005355|Ga0070671_101006069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
3300005458|Ga0070681_10677597 | Not Available | 946 | Open in IMG/M |
3300005471|Ga0070698_100903325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
3300005530|Ga0070679_101157337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
3300005537|Ga0070730_10222088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1254 | Open in IMG/M |
3300005538|Ga0070731_10041256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3093 | Open in IMG/M |
3300005602|Ga0070762_10111851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1594 | Open in IMG/M |
3300005607|Ga0070740_10350371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
3300005712|Ga0070764_10806951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300005764|Ga0066903_102737537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 957 | Open in IMG/M |
3300005921|Ga0070766_10202418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
3300006797|Ga0066659_10560110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 924 | Open in IMG/M |
3300006800|Ga0066660_10373213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1167 | Open in IMG/M |
3300006893|Ga0073928_11243579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis salina | 500 | Open in IMG/M |
3300009090|Ga0099827_11832306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300009101|Ga0105247_10251669 | Not Available | 1208 | Open in IMG/M |
3300009137|Ga0066709_103173135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
3300010359|Ga0126376_10547347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1082 | Open in IMG/M |
3300010379|Ga0136449_100356754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2623 | Open in IMG/M |
3300010876|Ga0126361_10035291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
3300010880|Ga0126350_11067634 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300012896|Ga0157303_10178174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300014325|Ga0163163_11040213 | Not Available | 882 | Open in IMG/M |
3300014493|Ga0182016_10407564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300016294|Ga0182041_11354385 | Not Available | 652 | Open in IMG/M |
3300016294|Ga0182041_11900014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300016319|Ga0182033_11081468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 716 | Open in IMG/M |
3300016341|Ga0182035_10153652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1771 | Open in IMG/M |
3300016357|Ga0182032_11825483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300016445|Ga0182038_10670659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
3300017926|Ga0187807_1102453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300017932|Ga0187814_10101713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1061 | Open in IMG/M |
3300017932|Ga0187814_10258596 | Not Available | 661 | Open in IMG/M |
3300017947|Ga0187785_10045010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1640 | Open in IMG/M |
3300017959|Ga0187779_10623446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300017961|Ga0187778_10507642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
3300017970|Ga0187783_10208870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. P24 | 1433 | Open in IMG/M |
3300017973|Ga0187780_10303417 | Not Available | 1123 | Open in IMG/M |
3300017973|Ga0187780_10354285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → Cryobacterium psychrotolerans | 1037 | Open in IMG/M |
3300017973|Ga0187780_11250991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300017975|Ga0187782_10579229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 861 | Open in IMG/M |
3300017975|Ga0187782_11273641 | Not Available | 576 | Open in IMG/M |
3300018035|Ga0187875_10479822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300018468|Ga0066662_11344346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300020062|Ga0193724_1057299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
3300020070|Ga0206356_10229032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1514 | Open in IMG/M |
3300020579|Ga0210407_10911378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
3300020580|Ga0210403_10804918 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300020582|Ga0210395_11019670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300021403|Ga0210397_11209650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300021404|Ga0210389_11208785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300021405|Ga0210387_10337802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1329 | Open in IMG/M |
3300021407|Ga0210383_10238818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1558 | Open in IMG/M |
3300021407|Ga0210383_10803245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea antri | 805 | Open in IMG/M |
3300021478|Ga0210402_11604435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300025509|Ga0208848_1001591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4304 | Open in IMG/M |
3300025899|Ga0207642_10114917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1378 | Open in IMG/M |
3300025916|Ga0207663_11318985 | Not Available | 581 | Open in IMG/M |
3300025929|Ga0207664_11270727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300025986|Ga0207658_11343421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300026490|Ga0257153_1016082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1519 | Open in IMG/M |
3300026550|Ga0209474_10651594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300027167|Ga0208096_104783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
3300027684|Ga0209626_1139102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300027765|Ga0209073_10076475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1147 | Open in IMG/M |
3300027884|Ga0209275_10573278 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300027884|Ga0209275_10911747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300028787|Ga0307323_10244702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
3300029910|Ga0311369_11250690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300030520|Ga0311372_10424864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1998 | Open in IMG/M |
3300030617|Ga0311356_11294963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
3300030677|Ga0302317_10431787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300031234|Ga0302325_10127044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4659 | Open in IMG/M |
3300031708|Ga0310686_105087077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter muralis | 622 | Open in IMG/M |
3300031718|Ga0307474_10471181 | Not Available | 983 | Open in IMG/M |
3300031718|Ga0307474_11253526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
3300031747|Ga0318502_10769754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300031751|Ga0318494_10287474 | Not Available | 947 | Open in IMG/M |
3300031779|Ga0318566_10280139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
3300031805|Ga0318497_10327662 | Not Available | 854 | Open in IMG/M |
3300031823|Ga0307478_11434309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300031833|Ga0310917_10496074 | Not Available | 831 | Open in IMG/M |
3300031860|Ga0318495_10356884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 647 | Open in IMG/M |
3300031890|Ga0306925_10729780 | Not Available | 1034 | Open in IMG/M |
3300031910|Ga0306923_11428013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300031946|Ga0310910_10934491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300032001|Ga0306922_10669383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 1095 | Open in IMG/M |
3300032001|Ga0306922_12140855 | Not Available | 541 | Open in IMG/M |
3300032043|Ga0318556_10745261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300032076|Ga0306924_11775650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300032160|Ga0311301_11818979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300032261|Ga0306920_101236894 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300032261|Ga0306920_101369387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1015 | Open in IMG/M |
3300032783|Ga0335079_10617074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1142 | Open in IMG/M |
3300032783|Ga0335079_10939050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
3300033805|Ga0314864_0028435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
3300033805|Ga0314864_0165752 | Not Available | 567 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.62% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.85% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.97% | |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027167 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_01058090 | 2124908016 | PGQPELMFWRVEAAPDQGATPGVYELRQDVATGAWTIRLN | |
deepsgr_01981140 | 2199352025 | Soil | AGTGPGQPELMFWRVEAAPGQGATPGVYALRRDVATGAWTIRLN |
JGIcombinedJ51221_100162843 | 3300003505 | Forest Soil | REWWQDPEAEPGQPELEFWRVEASPGQGMTASVCELRRDAATDAWTLRGGA* |
Ga0066869_100395731 | 3300005165 | Soil | AGTEAGQPELVFWRVEAAPGQGLTPAVYELRQDVATTAWTIRLT* |
Ga0070671_1010060692 | 3300005355 | Switchgrass Rhizosphere | GDAGIEPGQPELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN* |
Ga0070681_106775971 | 3300005458 | Corn Rhizosphere | EPGQPELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN* |
Ga0070698_1009033251 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | WQDPEAEPGQPELEFWRVEASPGQGMTAGVYELRRDAATDAWTLRLGA* |
Ga0070679_1011573371 | 3300005530 | Corn Rhizosphere | AAERGQPELEFWRVEAGPGQGVPPQVYELRRDAVAGTWTLREG* |
Ga0070730_102220881 | 3300005537 | Surface Soil | ELEFWRVEASSGQGLAAGVYELRRQVATGQWTLRRGLD* |
Ga0070731_100412562 | 3300005538 | Surface Soil | GQPELEFWRVEASLGPGLAAGVYELRREVATGQWTLRRGLD* |
Ga0070762_101118511 | 3300005602 | Soil | WRVEASSGPGMTAGIYELRREAATGAWTLRQGLA* |
Ga0070740_103503712 | 3300005607 | Surface Soil | ADPCEPELEFWRVEAAPGPAAPPGVYELRNEAGTGAWILR* |
Ga0070764_108069512 | 3300005712 | Soil | EWWRDPEAERGQPELEFWRVEATPGPAMTPGVYELRQEPATGLWTIRRGFA* |
Ga0066903_1027375371 | 3300005764 | Tropical Forest Soil | QPELEFWRVEASAGRGMTAGVYELRRDAAADTWTLRPN* |
Ga0070766_102024181 | 3300005921 | Soil | PELEFWRVEAAPGPATTSSVYELRRDSATSAWTLRR* |
Ga0066659_105601101 | 3300006797 | Soil | SGDPGAGPCQPELVFWRVEGAPGQGMTPEVCELRQDVASGAWTIRLN* |
Ga0066660_103732134 | 3300006800 | Soil | DPEAEPGEPELEFWRVEASMTSAMTPGVYEMRRETATGEWTVR* |
Ga0073928_112435791 | 3300006893 | Iron-Sulfur Acid Spring | HWVINREWWQDPAVPGPEPGQPELEFWRVEAAPGPGLAVAVYELRRETATGTWTLRRGLG |
Ga0099827_118323061 | 3300009090 | Vadose Zone Soil | SGTGPGQPELVFWRVEAAPGQGMTPEVYELRQDVATGAWTIRLN* |
Ga0105247_102516692 | 3300009101 | Switchgrass Rhizosphere | ELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN* |
Ga0066709_1031731352 | 3300009137 | Grasslands Soil | QPELVFWRVEAAPGQGMTSEVYELRQDVASGAWTIRLN* |
Ga0126376_105473471 | 3300010359 | Tropical Forest Soil | PELKFWRVEAATAPGPPAGVYELRQDVAAGAWTLLRVAD* |
Ga0136449_1003567545 | 3300010379 | Peatlands Soil | EQPVLEFWRVEAAPGPGTTARVCELRRQAAANAWTLRLGSGRLPRR* |
Ga0126361_100352911 | 3300010876 | Boreal Forest Soil | PRAEPGQPELEFWRVEASPGQGMTPGVYELRREAATGAWTLRVA* |
Ga0126350_110676341 | 3300010880 | Boreal Forest Soil | QPELEFWRVEAFLGTTMTPGVYELRRDAGTDTWTLRRGLRR* |
Ga0157303_101781741 | 3300012896 | Soil | GTEPGQPELMFWRVEAAPGQGMTPGIYELRQDVATGAWTIRRN* |
Ga0163163_110402131 | 3300014325 | Switchgrass Rhizosphere | QPELMFWRVEAAPGQGMTPGVYELRQDVATGAWTIRLN* |
Ga0182016_104075641 | 3300014493 | Bog | QEWWRDPGAEPGQPELEFWRVEASGGPGMTAGVHELRRDAATGIWTRRRSFA* |
Ga0182041_113543852 | 3300016294 | Soil | AEPGRPELEFWRVEAAPGQGMAAGVYELRRDVATGAWTLRLGAG |
Ga0182041_119000141 | 3300016294 | Soil | PGQPELEFWRVEAAPGRGMTPGVYELRRETATDTWTLRVS |
Ga0182033_110814681 | 3300016319 | Soil | REWWQDPEAEPGRPELEFWRVEASPGPGMKAAVYELRREIAAGAWTLRLGLG |
Ga0182035_101536523 | 3300016341 | Soil | GAGQPELEFWRVEAAPGRGMTSEVYELRQDIVTGTWTLRVN |
Ga0182032_118254831 | 3300016357 | Soil | PGRPELEFWRVEAAPGQGMTATVYELRRDAATDAWTLRLGVN |
Ga0182038_106706591 | 3300016445 | Soil | AGAEPGQPELEFWRVEAAPGQGMTPEVYELRRDATTGAWTLRVT |
Ga0187807_11024532 | 3300017926 | Freshwater Sediment | ISRETWRDRPEAGPGQPELEFWRVEAAPGPGTTARVYELRREAATNAWTLRLGSGRVPGR |
Ga0187814_100211881 | 3300017932 | Freshwater Sediment | PGQQEPGQPEPGQPDLEFWRVEASPGQGMTAGVYELRREAAADAWTLRAGT |
Ga0187814_101017132 | 3300017932 | Freshwater Sediment | PGPGQPQLEFWRVEAAPGPGTTAGVYELRWEAATNCWTLRGC |
Ga0187814_102585961 | 3300017932 | Freshwater Sediment | DEFWRVEAAPGPGMTAAVYELRREPATGTWSLRRDTG |
Ga0187809_100762153 | 3300017937 | Freshwater Sediment | EPGVPEPVQPQPGLPELEFWRVEASPGQGMAARVYELRRDDATDAWTLRLGAP |
Ga0187785_100450101 | 3300017947 | Tropical Peatland | EWWRDPVGAEPGQPELEFWRVEAAPGQGMTPEVYELRQDATTGAWTLRVT |
Ga0187779_106234461 | 3300017959 | Tropical Peatland | GQPELEFWRVEAAPGPGMTAGVYELRREVATDAWTLRPGID |
Ga0187778_105076423 | 3300017961 | Tropical Peatland | VDPGQPELEFWRVEAAPGPGMTAGVYELRREVATDAWTLRLGID |
Ga0187783_102088701 | 3300017970 | Tropical Peatland | PELEFWRVEASSGQGLAAAVYELRRQVATGQWTLRRGLD |
Ga0187780_103034171 | 3300017973 | Tropical Peatland | PELEFWRVEAAPGQGMAAGVYELRRDVATGAWTLRLGAG |
Ga0187780_103542851 | 3300017973 | Tropical Peatland | SPGDSGSEPGQPELEFWRVQAAPGQGMPPGVYELRRAAATGAWTLRA |
Ga0187780_112509911 | 3300017973 | Tropical Peatland | QPELEFWRVEAAPGPGRTADVYELRREIATNAWTLRLAG |
Ga0187782_105792291 | 3300017975 | Tropical Peatland | PGSEPGQPELEFWRVEAWPGPGMTAGVYELRHQTATGAWTLRLGLD |
Ga0187782_112736412 | 3300017975 | Tropical Peatland | PEVSGSEPGQPELEFWRVEASSGQGLATGVYELRKQVATGQWTLRQGLD |
Ga0187875_104798222 | 3300018035 | Peatland | WRDPEAERGQPELEFWRVEASPGPAMTPGVYELRREAATGTWTVRRGFD |
Ga0066662_113443462 | 3300018468 | Grasslands Soil | VTNREWWRDPGEAGEAGGPELEFWRVEAAPGPGVTPGVYELRRQTATSAWTMRQN |
Ga0193724_10572991 | 3300020062 | Soil | LMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN |
Ga0206356_102290321 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GIEPGQPELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN |
Ga0210407_109113782 | 3300020579 | Soil | ELEFWRVEASAGQGMTASVYELRRDAATDAWTLRGGA |
Ga0210403_108049182 | 3300020580 | Soil | PELEFWRVEASAGQGMTASVYELRRDAATDAWTLRGGA |
Ga0210395_110196702 | 3300020582 | Soil | EEHWVINREWWQDPAVPGPEPGQPELEFWRVEAAAGPGLAAAVYELRRETATGTWTLRRGLG |
Ga0210397_112096501 | 3300021403 | Soil | PELEFWRVEAAPGQGMLPGVYELRREFPAGTWTLRRGFH |
Ga0210389_112087851 | 3300021404 | Soil | PELMFWRVEAAPGQGMTPGVYELRQDVATGAWTIRLN |
Ga0210387_103378021 | 3300021405 | Soil | EFWRVEAAPGQGMPPGVYELRREFPAGTWTLRRGFH |
Ga0210383_102388181 | 3300021407 | Soil | PEPGQPELEFWRVEAAAGPGLAAAVYELRRETATGTWTLRRGLG |
Ga0210383_108032451 | 3300021407 | Soil | EAEPGRPELEFWRVEASPGQGMTAGVYELRRDAATDAWTLRLGA |
Ga0210402_116044351 | 3300021478 | Soil | GQPELEFWRVEAAPGQGRTPEFYELRQDVATGAWTIRP |
Ga0208848_10015911 | 3300025509 | Arctic Peat Soil | QPELEFWRVEAAPGQGVPSQLYELRRDPAVGTWTIRPS |
Ga0207642_101149173 | 3300025899 | Miscanthus Rhizosphere | DAGIEPGQPELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN |
Ga0207663_113189851 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EPGQAEPGQPELEFWRVEASPGLGLTAEVYDLRRDAAGAWTLRSQSGP |
Ga0207664_112707272 | 3300025929 | Agricultural Soil | QPELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN |
Ga0207658_113434212 | 3300025986 | Switchgrass Rhizosphere | PELMFWRVEAAPGQGATPGVYELRQDVATGAWTIRLN |
Ga0257153_10160821 | 3300026490 | Soil | WRDPAGAEPEQPELEFWRVEAAPGRGLAVGLYELRRDAAGTWVLRVN |
Ga0209474_106515942 | 3300026550 | Soil | TNREWWRDPGEAGEAGGPELEFWRVEAAPGPGVTPGVYELRRQTATSAWTMRQN |
Ga0208096_1047831 | 3300027167 | Forest Soil | VLQDDGEPVAAPEAEPGQPELEFWRVEASPGQGMTASVYELRRDAATDAWTLRLGA |
Ga0209626_11391022 | 3300027684 | Forest Soil | ADPGNAGTGPGQPELVFWRVEAAPGQGMAPEVYELRQDVASGAWTIRLN |
Ga0209073_100764753 | 3300027765 | Agricultural Soil | QPELMFWRVEAAPGQGTTPGVYELRQDVATGAWTIRLN |
Ga0209275_105732781 | 3300027884 | Soil | EWWQQPEDEPRQPELVFWRVEAAPGQGMATGVYELRREMATNTWTLRRAAD |
Ga0209275_109117471 | 3300027884 | Soil | PRAEPGQPELEFWRVEASPGQGMTPGVYELRREAAAGAWTLRVG |
Ga0307323_102447022 | 3300028787 | Soil | DSGDAGTEPGQPELMFWRVEATPGQGATPGVYELRQDVATGAWTIRLN |
Ga0311369_112506901 | 3300029910 | Palsa | RPELEFWRVEASGGPGMTAGVYELRREAATDAWTLRQGLA |
Ga0311372_104248645 | 3300030520 | Palsa | AERGQPELEFWRVEASSGPAMTAGIHELRREAATGIWTIRRGFS |
Ga0311356_112949632 | 3300030617 | Palsa | EAERGQPELEFWRVEASSGPAMTAGIHELRREAATGIWTIRRGFS |
Ga0302317_104317872 | 3300030677 | Palsa | ERGQPELEFWRVEASLGPAMTAGVYELRREAATGIWAVRRGFD |
Ga0302325_101270441 | 3300031234 | Palsa | WRDPEAERGQPELEFWRVEASSGPAMTAGIHELRREAATGIWTIRRGFS |
Ga0310686_1050870771 | 3300031708 | Soil | GQPELEFWRVEASMGPGMVADIYELRHEPATDTWTLRPGY |
Ga0307474_104711811 | 3300031718 | Hardwood Forest Soil | GPGQPELVFWRVEAAPGQGMTPEVYELRQDVATGAWTIRLN |
Ga0307474_112535261 | 3300031718 | Hardwood Forest Soil | GQPELEFWRVEASPGQGITAGVYELRRDAATDAWTLRLGA |
Ga0318502_107697542 | 3300031747 | Soil | PLAPMGSEPGQPELEFWRVEASSGPGMTTSLYELRREIATGAWTLRR |
Ga0318494_102874742 | 3300031751 | Soil | RPELEFWRVEAAPGQGMTATVYELRRDAATDAWTLRLGVN |
Ga0318566_102801392 | 3300031779 | Soil | TEPGQPELEFWRVEAAPGQGMTPAVYELRQDVATGAWTLRVN |
Ga0318497_103276621 | 3300031805 | Soil | GQPELEFWRVEAAPGQGMAAGVYELRRDVATGAWTLRLGAG |
Ga0307478_114343092 | 3300031823 | Hardwood Forest Soil | EPGQPELEFWRVEASPGQGMTAGVYELRRDAATDAWTLRLGP |
Ga0310917_104960741 | 3300031833 | Soil | PEAEPGRPELEFWRVEAAPGQGMTATVYELRRDAATDAWTLRPGTS |
Ga0318495_103568841 | 3300031860 | Soil | WADPAPLGPELGQPELEFWRVEASPGPGMKAAVYELRREIAVGAWTLRLGLG |
Ga0306925_107297801 | 3300031890 | Soil | LEFWRVEAAPGTGMPPGVFELRRETVTGAWTLRPPA |
Ga0306923_114280131 | 3300031910 | Soil | EPGRPELEFWRVEAAPGQGMTATVYELRRDAATDAWTLRLGVN |
Ga0310910_109344912 | 3300031946 | Soil | ELEFWRVQASPGPGMTAGVYELRREPASGAWTLRY |
Ga0306922_106693831 | 3300032001 | Soil | PGQPELEFWRVEAAPGQGMAAGVYELRRDVATGAWTLRLGAG |
Ga0306922_121408552 | 3300032001 | Soil | PEAEPGRPELEFWRVEAAPGQGMAAGVYELRRDLATDAWTLRLGAS |
Ga0318556_107452611 | 3300032043 | Soil | AGAEPGQPELEFWRVEAAPGQGMTPEVYELRQDATTGAWTLRVT |
Ga0306924_117756501 | 3300032076 | Soil | WQDPPLAPMGSEPGQPELEFWRVEASSGPGMTTSLYELRREIATGAWTLRR |
Ga0311301_118189792 | 3300032160 | Peatlands Soil | LEFWRVEAAPSPGLTAAVYELRRETAAGTWTLRRG |
Ga0306920_1012368943 | 3300032261 | Soil | LEFWRVEAAPGQGMAAGVYELRRDVATGAWTLRLGAG |
Ga0306920_1013693871 | 3300032261 | Soil | PEAEPGRPELEFWRVEAAPGQGMTTGVYELRRDAATDAWTLRLGAS |
Ga0335079_106170742 | 3300032783 | Soil | RPELEFWRVEAAPGQGVTTEVYELRRDAAIDAWTLRRTV |
Ga0335079_109390501 | 3300032783 | Soil | PVGSEPGQPELEFWRVEAAPGQGMTPEVYELRQDATTGAWTLRVT |
Ga0314864_0028435_1063_1200 | 3300033805 | Peatland | EPGSGPGQPELEFWRVEAAPGPGTTAGVYELRREAATDIWTLRGC |
Ga0314864_0165752_433_567 | 3300033805 | Peatland | AEPSQHELEFWRVEASSGPGATAGVYELRRDAATDAWTLRLGAC |
⦗Top⦘ |