| Basic Information | |
|---|---|
| Family ID | F098975 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVVTDGGSE |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.26 % |
| % of genes near scaffold ends (potentially truncated) | 94.17 % |
| % of genes from short scaffolds (< 2000 bps) | 83.50 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (19.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.301 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.835 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.58% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02310 | B12-binding | 10.68 |
| PF12681 | Glyoxalase_2 | 6.80 |
| PF04055 | Radical_SAM | 5.83 |
| PF01863 | YgjP-like | 5.83 |
| PF00903 | Glyoxalase | 4.85 |
| PF01797 | Y1_Tnp | 2.91 |
| PF13378 | MR_MLE_C | 2.91 |
| PF00496 | SBP_bac_5 | 1.94 |
| PF07883 | Cupin_2 | 1.94 |
| PF11867 | DUF3387 | 1.94 |
| PF10047 | DUF2281 | 1.94 |
| PF04002 | RadC | 0.97 |
| PF04313 | HSDR_N | 0.97 |
| PF07355 | GRDB | 0.97 |
| PF02746 | MR_MLE_N | 0.97 |
| PF08402 | TOBE_2 | 0.97 |
| PF00528 | BPD_transp_1 | 0.97 |
| PF07978 | NIPSNAP | 0.97 |
| PF09084 | NMT1 | 0.97 |
| PF00856 | SET | 0.97 |
| PF08281 | Sigma70_r4_2 | 0.97 |
| PF13379 | NMT1_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 5.83 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.91 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.94 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.97 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.97 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10084431 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 676 | Open in IMG/M |
| 3300000890|JGI11643J12802_10144291 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300000956|JGI10216J12902_101136796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300004013|Ga0055465_10206234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300004156|Ga0062589_101008510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 778 | Open in IMG/M |
| 3300004782|Ga0062382_10573391 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005328|Ga0070676_11586256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005332|Ga0066388_100035660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4795 | Open in IMG/M |
| 3300005444|Ga0070694_100035623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3291 | Open in IMG/M |
| 3300005546|Ga0070696_101668922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300005549|Ga0070704_100078256 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
| 3300005561|Ga0066699_10656172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300005874|Ga0075288_1005466 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300005895|Ga0075277_1036477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300005900|Ga0075272_1031003 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005937|Ga0081455_10097146 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300006049|Ga0075417_10031177 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300006049|Ga0075417_10063704 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300006797|Ga0066659_11362272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300006844|Ga0075428_100393404 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300006844|Ga0075428_101682227 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006845|Ga0075421_101329090 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006847|Ga0075431_100314966 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300006847|Ga0075431_101252650 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
| 3300006871|Ga0075434_100352202 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300006871|Ga0075434_100443452 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300006871|Ga0075434_100842023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300006880|Ga0075429_100505063 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300006903|Ga0075426_11042559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300006903|Ga0075426_11191187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300006904|Ga0075424_101451473 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009147|Ga0114129_10177990 | All Organisms → cellular organisms → Bacteria | 2896 | Open in IMG/M |
| 3300009157|Ga0105092_10727500 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009157|Ga0105092_10859455 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300009162|Ga0075423_10039227 | All Organisms → cellular organisms → Bacteria | 4839 | Open in IMG/M |
| 3300009162|Ga0075423_10435050 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300009506|Ga0118657_10789222 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300010359|Ga0126376_10412972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1220 | Open in IMG/M |
| 3300010360|Ga0126372_10020086 | All Organisms → cellular organisms → Bacteria | 3917 | Open in IMG/M |
| 3300010360|Ga0126372_10501400 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300010361|Ga0126378_11006967 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300010361|Ga0126378_11077871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300010375|Ga0105239_10078941 | All Organisms → cellular organisms → Bacteria | 3622 | Open in IMG/M |
| 3300010376|Ga0126381_100898912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1275 | Open in IMG/M |
| 3300010400|Ga0134122_10423770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300010401|Ga0134121_12293000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300010938|Ga0137716_10018144 | All Organisms → cellular organisms → Bacteria | 10808 | Open in IMG/M |
| 3300011409|Ga0137323_1068277 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 783 | Open in IMG/M |
| 3300011439|Ga0137432_1078852 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1014 | Open in IMG/M |
| 3300011444|Ga0137463_1060402 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012039|Ga0137421_1189180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
| 3300012171|Ga0137342_1005912 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300012202|Ga0137363_10607025 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300012902|Ga0157291_10213656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
| 3300012923|Ga0137359_10925341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300012944|Ga0137410_11394378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300012948|Ga0126375_11207877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 630 | Open in IMG/M |
| 3300012951|Ga0164300_10308609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300012987|Ga0164307_11716975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300013100|Ga0157373_11073441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300013102|Ga0157371_10190721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1467 | Open in IMG/M |
| 3300014866|Ga0180090_1038483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300015373|Ga0132257_102754724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300015374|Ga0132255_103811041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300018031|Ga0184634_10456994 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018054|Ga0184621_10089962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1076 | Open in IMG/M |
| 3300018063|Ga0184637_10059058 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300018072|Ga0184635_10417363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300018077|Ga0184633_10044458 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300018079|Ga0184627_10002749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7448 | Open in IMG/M |
| 3300018082|Ga0184639_10385875 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300018083|Ga0184628_10534594 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021081|Ga0210379_10284410 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021082|Ga0210380_10111686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1212 | Open in IMG/M |
| 3300021432|Ga0210384_11897055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300025312|Ga0209321_10117398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1454 | Open in IMG/M |
| 3300025903|Ga0207680_10969282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300025912|Ga0207707_10730562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300025933|Ga0207706_10013915 | All Organisms → cellular organisms → Bacteria | 7295 | Open in IMG/M |
| 3300025933|Ga0207706_10028034 | All Organisms → cellular organisms → Bacteria | 5031 | Open in IMG/M |
| 3300025939|Ga0207665_10534956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 909 | Open in IMG/M |
| 3300026075|Ga0207708_11136173 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 682 | Open in IMG/M |
| 3300026088|Ga0207641_10403704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1313 | Open in IMG/M |
| 3300027778|Ga0209464_10181773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 746 | Open in IMG/M |
| 3300027873|Ga0209814_10002780 | All Organisms → cellular organisms → Bacteria | 6460 | Open in IMG/M |
| 3300027886|Ga0209486_10972116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 568 | Open in IMG/M |
| 3300027909|Ga0209382_10627412 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300027909|Ga0209382_12054990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300028420|Ga0210366_10402443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300031548|Ga0307408_100078404 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300031820|Ga0307473_11222450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 559 | Open in IMG/M |
| 3300031858|Ga0310892_10056718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1971 | Open in IMG/M |
| 3300031947|Ga0310909_10584106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300032002|Ga0307416_101097078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 900 | Open in IMG/M |
| 3300032003|Ga0310897_10705359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300032179|Ga0310889_10597374 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300032180|Ga0307471_101055920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 979 | Open in IMG/M |
| 3300032180|Ga0307471_103760896 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300032205|Ga0307472_101997792 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032828|Ga0335080_12398112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300033481|Ga0316600_10396701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 946 | Open in IMG/M |
| 3300034147|Ga0364925_0245855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300034148|Ga0364927_0117591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 19.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.97% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100844311 | 3300000793 | Forest Soil | MKVAQIETAVLEMPYIKPLVTAANNFTVARGVLAKVV |
| JGI11643J12802_101442911 | 3300000890 | Soil | MKIETIETTILEMPYTKPLITATNHFTVARGLLVKVVTDGGLPGY |
| JGI10216J12902_1011367962 | 3300000956 | Soil | MKIGKVTNIETTILEMPYTKPLVTATNNFTVARGILVKVITE |
| Ga0055465_102062342 | 3300004013 | Natural And Restored Wetlands | VRIAQIETTKLEMPYKKPLVTATNNFTVARGLLVKAVTDEGVEGYGYS |
| Ga0062589_1010085102 | 3300004156 | Soil | MKIEKITTKKLEMPYTKPLVTATNNFTVARGLLVTVVTNGG |
| Ga0062382_105733912 | 3300004782 | Wetland Sediment | MKVESIDTKMLEMPYTKPLVTATNNFTVARGLLVTVVTNGGVEGY |
| Ga0070676_115862561 | 3300005328 | Miscanthus Rhizosphere | MKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIEG |
| Ga0066388_1000356605 | 3300005332 | Tropical Forest Soil | MRIEQIETTVLEMPYTKPLVTATNNFTVACGVLAKVVTDTGMEG |
| Ga0070694_1000356235 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEG |
| Ga0070696_1016689221 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIE |
| Ga0070704_1000782564 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGYSD |
| Ga0066699_106561721 | 3300005561 | Soil | MKIGKVGNIETTVLEMPYTKPLVTATNNFTVARGLLVKV |
| Ga0075288_10054661 | 3300005874 | Rice Paddy Soil | MKIARIDTRALEMPYTKPLVTATNNFTVARGLLVTVVTDS |
| Ga0075277_10364772 | 3300005895 | Rice Paddy Soil | MKIGKVAKVETTILEMPYSKPLVTATNNFTVARGLLVKVITE |
| Ga0075272_10310032 | 3300005900 | Rice Paddy Soil | MKIGKVAKVETTILEMPYSKPLVTATNNFTVARGLLVKVITEGGIEGYG |
| Ga0081455_100971463 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKIDRIETTGLEMPYKKPLITATNNFTVARGSGGVLE* |
| Ga0075417_100311771 | 3300006049 | Populus Rhizosphere | MRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLEGYG |
| Ga0075417_100637042 | 3300006049 | Populus Rhizosphere | VKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLEG |
| Ga0066659_113622721 | 3300006797 | Soil | MKIGKVGNIETTVLEMPYTKRLVTATNNFTVARGLLVKVITD |
| Ga0075428_1003934041 | 3300006844 | Populus Rhizosphere | MRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLEGYGY |
| Ga0075428_1016822271 | 3300006844 | Populus Rhizosphere | MKIGKVINIETTILEMPYTKPLVTATNNFTVARGILVKVITEGGIEG |
| Ga0075421_1013290901 | 3300006845 | Populus Rhizosphere | MKIDTIETTVLEMPYEKPLVTATNNFTVARGLLVKVITDGGLEGYGY |
| Ga0075431_1003149663 | 3300006847 | Populus Rhizosphere | MRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVI |
| Ga0075431_1012526501 | 3300006847 | Populus Rhizosphere | VKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLE |
| Ga0075434_1003522021 | 3300006871 | Populus Rhizosphere | MRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITN |
| Ga0075434_1004434522 | 3300006871 | Populus Rhizosphere | VKIDQIETTVLEMPYKKPLVTATNNFTVARGLLVKVVTDAGVEGY |
| Ga0075434_1008420231 | 3300006871 | Populus Rhizosphere | MKIGKVAGVETRLLEMPYTKPLVTATNNFTVARGLL |
| Ga0075429_1005050632 | 3300006880 | Populus Rhizosphere | MKIDTIETTVLEMPYEKPLVTATNNFTVARGLLVKVITDGGL |
| Ga0075426_110425592 | 3300006903 | Populus Rhizosphere | MKIGKVINIETTILEMPYTKPLVTATNNFTVARGIL |
| Ga0075426_111911872 | 3300006903 | Populus Rhizosphere | MKIGKVAGVETRLLEMPYTKPLVTATNNFTVARGLLVKVITD |
| Ga0075424_1014514732 | 3300006904 | Populus Rhizosphere | MRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITNGGLEGYGY |
| Ga0114129_101779904 | 3300009147 | Populus Rhizosphere | VKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITNGGLEG |
| Ga0105092_107275001 | 3300009157 | Freshwater Sediment | MKIEHIETTVLEMPYKKPLVTATNNFTVARGLLVKLVTDDGVE |
| Ga0105092_108594551 | 3300009157 | Freshwater Sediment | MKIKQIETTVLEMPYKKPLVTATNNFTVARGLLVKLVTDDGVEGYGY |
| Ga0075423_100392271 | 3300009162 | Populus Rhizosphere | MKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGY |
| Ga0075423_104350504 | 3300009162 | Populus Rhizosphere | VKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITNGGLEGYGY |
| Ga0118657_107892222 | 3300009506 | Mangrove Sediment | MKIEHIESTILEMPYKKPLITATNKFVVARGVLVKVIAAGIDGYGYADLF |
| Ga0126376_104129722 | 3300010359 | Tropical Forest Soil | MKVAQIETTVLEMPYTKPLVTATNNFTVACGVLAKVVTDTGMEGLRL |
| Ga0126372_100200861 | 3300010360 | Tropical Forest Soil | VKIEQIETTVLEMPYIKPLVTATNNFTVARGILAKVVTDTAVEGYGYAD |
| Ga0126372_105014001 | 3300010360 | Tropical Forest Soil | MKCYAVEIQMKVERIETTVLEMPYTKPLVTATNNFTVARGILAKVVTDTAVEGYG |
| Ga0126378_110069673 | 3300010361 | Tropical Forest Soil | MRIEQIETTVLEMPYTKPLVTATNNFTVACGVLAKVVTDTGMEGLRLR |
| Ga0126378_110778711 | 3300010361 | Tropical Forest Soil | MKIGKVATVETTILEMPYTKPLVTATNNFTVARGI |
| Ga0105239_100789415 | 3300010375 | Corn Rhizosphere | MKIGKVINIETTILEMPYTKPLVTATNNFTVAHGILVK |
| Ga0126381_1008989122 | 3300010376 | Tropical Forest Soil | VKIEQIETTVLEMPYKKPLVTATNNFTLARGLLIKVVTNAEW |
| Ga0134122_104237701 | 3300010400 | Terrestrial Soil | MKIGKVTNIETTILEMPYTKPLVTATNNFTVARGILVKVITEGG |
| Ga0134121_122930002 | 3300010401 | Terrestrial Soil | MKIGKVTNIETTILEMPYTKPLVTATNNFTVARGILVKVI |
| Ga0137716_1001814414 | 3300010938 | Hot Spring Fe-Si Sediment | MKIAKIDTRVLELPYTKPLVTATNNFTVARGLLVTVASETGI |
| Ga0137323_10682772 | 3300011409 | Soil | MKIERVETKKLEMPYIKPLVTATNNFTVARGLLVTV |
| Ga0137432_10788521 | 3300011439 | Soil | MKIERVETKKLEMPYIKPLVTATNNFTVARGLLVTVATNGG |
| Ga0137463_10604023 | 3300011444 | Soil | MKIESVETEKLEMPYTKPLVTATNTFTVASGLLVTVRTNGGVEGY |
| Ga0137421_11891801 | 3300012039 | Soil | MKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVTQSGVEGYGYADL |
| Ga0137342_10059121 | 3300012171 | Soil | VIPVKINRIETTKLDMPYKKPLVTATNNFTIARGLLVKAVTDEGVEGY |
| Ga0137363_106070251 | 3300012202 | Vadose Zone Soil | MKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVVTDGGSE |
| Ga0157291_102136561 | 3300012902 | Soil | MKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVTSGGVE |
| Ga0137359_109253411 | 3300012923 | Vadose Zone Soil | MKIGKVAGIETTQLEMPYTKPLVTATNNFTVARGLLVKVITD |
| Ga0137410_113943781 | 3300012944 | Vadose Zone Soil | MKIGKVAGIETTQLAMPYTKPLVTETNNFTVARGLLVKV |
| Ga0126375_112078771 | 3300012948 | Tropical Forest Soil | VKIEQIETTVLEMPYKKPLVTATNNFTLARGLLIKVVTNAEWKD |
| Ga0164300_103086092 | 3300012951 | Soil | MTIGKVTGVETSLLEMPYTKPLVTATNNFTVARGLLAKVITDG |
| Ga0164307_117169751 | 3300012987 | Soil | MKIGKVINIETTILEMPYTKPLVTATNNFTVAHGILVKVITEG |
| Ga0157373_110734411 | 3300013100 | Corn Rhizosphere | MKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITE |
| Ga0157371_101907213 | 3300013102 | Corn Rhizosphere | MKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYG |
| Ga0180090_10384832 | 3300014866 | Soil | MKIVQIETHILEMPYTKPLVTATNNFTVARGLLVKVVTDGGV* |
| Ga0132257_1027547241 | 3300015373 | Arabidopsis Rhizosphere | MTTGKVTGVETSLLAMPYTKPLVTATNNFTVARGLLAKVITDGGIEGYG |
| Ga0132255_1038110411 | 3300015374 | Arabidopsis Rhizosphere | MKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKV |
| Ga0184634_104569941 | 3300018031 | Groundwater Sediment | MKIAQIETRLLEMPYTKPLITATNNFTVARGLLVKAVTGATCCCRGS |
| Ga0184621_100899621 | 3300018054 | Groundwater Sediment | MKVTDVETRTLEMPYTKPLVTATNNFTVARGVLVKVVT |
| Ga0184637_100590583 | 3300018063 | Groundwater Sediment | MKIAQVETRALEMPYTKPLITATNNFTVARGLLVKAVTGATCCCRGS |
| Ga0184635_104173632 | 3300018072 | Groundwater Sediment | MKIASIDTRTLEMPYTKPLVTATNNFTVARGLLVTVV |
| Ga0184633_100444583 | 3300018077 | Groundwater Sediment | MKIAQIETRALEMPYTKPLITATNNFTVARGLLVKAVTDAGVEGYG |
| Ga0184627_100027496 | 3300018079 | Groundwater Sediment | MKIAQIETRALEMPYTKPLITATNNFTVARGLLVKAVTGATCCCRGS |
| Ga0184639_103858751 | 3300018082 | Groundwater Sediment | MKIEKVETKKLEMLYTKPLVTATNNFTVARGLLVT |
| Ga0184628_105345941 | 3300018083 | Groundwater Sediment | MKIERVETKKLEMPYTKPLVTATNNFTVARGLLVTVR |
| Ga0210379_102844101 | 3300021081 | Groundwater Sediment | VKINRIETTKLDMPYRKPLVTATNNFTIARGLLVK |
| Ga0210380_101116861 | 3300021082 | Groundwater Sediment | MKIEKIETRKLEMPYTKPLVTATNNFTVARGLLVTVGTHGGV |
| Ga0210384_118970552 | 3300021432 | Soil | MKVIQIETTVLEMPYTKPLVTATNNFTVARGVLAKVVTNTGVEGYGYADLF |
| Ga0209321_101173981 | 3300025312 | Soil | MKIAQIETRPLEMPYTRPLVAATNNFTVARGLLVKAVMD |
| Ga0207680_109692822 | 3300025903 | Switchgrass Rhizosphere | MKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGY |
| Ga0207707_107305622 | 3300025912 | Corn Rhizosphere | MKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGYS |
| Ga0207706_100139159 | 3300025933 | Corn Rhizosphere | MKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGI |
| Ga0207706_100280341 | 3300025933 | Corn Rhizosphere | MKIGKVINIETTILEMPYTKPLVTATNNFTVARGILVKVITEGGI |
| Ga0207665_105349562 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGKVAGVETRLLEMPYTKPLVTATNNFTVARGLLVKVIT |
| Ga0207708_111361732 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIERVETKKLEMPYTKPLVTATNNFTVARGLLVTVRTNG |
| Ga0207641_104037042 | 3300026088 | Switchgrass Rhizosphere | MTIGKVTGVETSLLEMPYTKPLVTATNNFTVARGL |
| Ga0209464_101817731 | 3300027778 | Wetland Sediment | MKVESIDTKMLEMPYTKPLVTATNNFTVARGLLVTVVTNGGVEGYGYA |
| Ga0209814_100027809 | 3300027873 | Populus Rhizosphere | VKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGIEGYGY |
| Ga0209486_109721162 | 3300027886 | Agricultural Soil | MKIETVETTVLEMPYTKPLITATNHFTVARGLLVRVV |
| Ga0209382_106274123 | 3300027909 | Populus Rhizosphere | MRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITD |
| Ga0209382_120549901 | 3300027909 | Populus Rhizosphere | MRIEQIESTVLEMPYIKPLVTATNNFTVACGLLVKVVTDGGLEGY |
| Ga0210366_104024431 | 3300028420 | Estuarine | MKIGKIAKVETTVLEMPYSKPLVTATNNFTVARGLLVKVVTDG |
| Ga0307408_1000784043 | 3300031548 | Rhizosphere | MKIEKIATKKLEMPYTKPLVTATNNFTVARGLLVTVVTSGGVEGYG |
| Ga0307473_112224502 | 3300031820 | Hardwood Forest Soil | MKVIQVETIVLEMPYTKPLITATNNFTVARGVLAKVVTNTG |
| Ga0310892_100567183 | 3300031858 | Soil | MKIETVETTILEMPYSKPLITATNHFTVARGLLVKVVTDGGVS |
| Ga0310909_105841062 | 3300031947 | Soil | MKIDQIETTVLEMPYIKPLVTATNNFTVARGLLVKVITD |
| Ga0307416_1010970782 | 3300032002 | Rhizosphere | MKIKTVETTVLEMPYTKPLITATNHFTVARGLLVKVVTDKGAQG |
| Ga0310897_107053592 | 3300032003 | Soil | MKIEKIATKKLEMPYTKPLVTATNNFTVARGLLVTV |
| Ga0310889_105973741 | 3300032179 | Soil | MKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVT |
| Ga0307471_1010559201 | 3300032180 | Hardwood Forest Soil | MTIGKVTGVETSLLEMPYTKPLVTATNNFTVARGLLAK |
| Ga0307471_1037608961 | 3300032180 | Hardwood Forest Soil | MKIDQIETTVLEMPYTKPLVTATNNFTVACGLLVKVVTDGGI |
| Ga0307472_1019977921 | 3300032205 | Hardwood Forest Soil | MIIDQIETTVLEMPYKKPLVTATNNFTVARGLLVKVVTDAGVEG |
| Ga0335080_123981121 | 3300032828 | Soil | MKINQIETTVLEMPYTKPLVTATNNFTVARGVLVKAITDSGIEGYGYA |
| Ga0316600_103967011 | 3300033481 | Soil | MKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVTQGGVEGYGYAD |
| Ga0364925_0245855_388_522 | 3300034147 | Sediment | VKINRIETTKLDMPYKKPLVTATNNFTIAHGLLVKAVTDEGVEG |
| Ga0364927_0117591_627_746 | 3300034148 | Sediment | IETTKLDMPYKKPLVTATNNFTIAHGLLVKAVTDEGVEG |
| ⦗Top⦘ |