| Basic Information | |
|---|---|
| Family ID | F098956 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.84 % |
| % of genes near scaffold ends (potentially truncated) | 50.49 % |
| % of genes from short scaffolds (< 2000 bps) | 95.15 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.117 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (20.388 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.359 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.864 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 63.64% β-sheet: 0.00% Coil/Unstructured: 36.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01434 | Peptidase_M41 | 0.97 |
| PF01609 | DDE_Tnp_1 | 0.97 |
| PF03050 | DDE_Tnp_IS66 | 0.97 |
| PF01555 | N6_N4_Mtase | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.97 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.97 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.97 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.97 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.97 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.12 % |
| All Organisms | root | All Organisms | 3.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 20.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034480 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063356_1054934731 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VHLREEGARLGKHLAMLEVLREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0058863_114512711 | 3300004799 | Host-Associated | SNAPACLCIHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0058862_118480261 | 3300004803 | Host-Associated | NAPACLCIHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0065704_103101662 | 3300005289 | Switchgrass Rhizosphere | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLNAMYGIPL* |
| Ga0066388_1025838932 | 3300005332 | Tropical Forest Soil | MGALPLYNAPACLCIHVHLREEGARLGKHLAMLEALREVRRRVSYWTSGADLTAMHCILL |
| Ga0066692_106448521 | 3300005555 | Soil | ALPLYNAPECLVIHVHLREEGVRLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL* |
| Ga0068857_1001335492 | 3300005577 | Corn Rhizosphere | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLKAIHGIPL* |
| Ga0068859_1000416031 | 3300005617 | Switchgrass Rhizosphere | PLRKEGARQGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0081455_105664861 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MREVRLGKHLAMLEALREVRRRVAYWTSGADLKAMHGIPL* |
| Ga0081540_12822541 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VHLREEGARLGKHLAMLEALREVRRRVAYWTSGADLNAMHGIPL* |
| Ga0066660_114014222 | 3300006800 | Soil | RLGKHLAMLEALREVMRRVSYWTSGADLTAMHGIPL* |
| Ga0075425_1010938073 | 3300006854 | Populus Rhizosphere | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLNAM |
| Ga0075435_1008151482 | 3300007076 | Populus Rhizosphere | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL* |
| Ga0099794_103011091 | 3300007265 | Vadose Zone Soil | VHLREEGVRLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL* |
| Ga0111539_104674152 | 3300009094 | Populus Rhizosphere | VHLRKEGARLGKHLAMLEALREVRRRVADWTSGADLHAMHGISL* |
| Ga0075418_115029182 | 3300009100 | Populus Rhizosphere | VHLREEGARLGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0114129_115012811 | 3300009147 | Populus Rhizosphere | VHLRKEGARLGKHLAMLEVLREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0105243_112181551 | 3300009148 | Miscanthus Rhizosphere | IHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIHL* |
| Ga0111538_127648132 | 3300009156 | Populus Rhizosphere | VHLRKEGARLGKHLAMLEALREVRRRVADWISGADLHAMHGISL* |
| Ga0105249_111026601 | 3300009553 | Switchgrass Rhizosphere | MGALPLSNAPECLCIHVHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL |
| Ga0126374_105154391 | 3300009792 | Tropical Forest Soil | VPLREEGARLGKHLAMLEALREVRRRVSYWTSGADLTAMHGIPL* |
| Ga0126314_111009262 | 3300010042 | Serpentine Soil | VHLREEGARLGKHLAMLEALREVIRRVAYWTSGADLHAMHGIPL* |
| Ga0126384_101304912 | 3300010046 | Tropical Forest Soil | VHLREEGVRLGKHLAMLEALREVRRRVAYWTSGADLHAMHGIPA* |
| Ga0126384_115204471 | 3300010046 | Tropical Forest Soil | EGVRLGKHLAMLEALREVRRRVSYWTSGADLTAMHGIPL* |
| Ga0126382_101989361 | 3300010047 | Tropical Forest Soil | MGALSLDNAPACLGIHVPLREEGVRLGKHLAMLEALREVRRRVAYWTSGADL |
| Ga0127469_1301211 | 3300010082 | Grasslands Soil | HLREEGARLGKHLAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0127473_10811781 | 3300010096 | Grasslands Soil | RLGKHLAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0127463_10380701 | 3300010098 | Grasslands Soil | QVHLREEGARLGKHRAMLEALREVMRRVAYWTSGADLHAMHGIPL* |
| Ga0127472_10746011 | 3300010106 | Grasslands Soil | QLHLREEGARRGKHLAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0127488_11632971 | 3300010122 | Grasslands Soil | QVHLREEGARLGKHRAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0127482_10717661 | 3300010126 | Grasslands Soil | HYPSTTLQVHLREEGARLGKHPAMLEALREVMRRVAYWTSGADLHAMHGIPL* |
| Ga0127447_11576371 | 3300010136 | Grasslands Soil | ARLGKHRAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0127464_10344741 | 3300010139 | Grasslands Soil | LQVHLREEGARLGKHRAMLEALREVMRRVSYWTSGADLHALHGIPL* |
| Ga0126372_104746022 | 3300010360 | Tropical Forest Soil | VHLREEGVRLGKHLVMLEALREARRRVAYWTSGADLTAMHGIPL* |
| Ga0126378_111602092 | 3300010361 | Tropical Forest Soil | VHLRDEGVRLGKHLAMLEALREVRRRVSYWTSGADLPAMHGIPL* |
| Ga0126377_112784462 | 3300010362 | Tropical Forest Soil | MGALPLDNAPACLCIHVHLREEGARLGKHLAMLEALREVRRRVSYWTSGADLPAMHGIPL |
| Ga0137391_106053802 | 3300011270 | Vadose Zone Soil | VPLREEGARLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL* |
| Ga0150985_1177461731 | 3300012212 | Avena Fatua Rhizosphere | GKHRAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0150985_1183570082 | 3300012212 | Avena Fatua Rhizosphere | MREFRLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL* |
| Ga0137370_107823391 | 3300012285 | Vadose Zone Soil | MEEGTRLGKHLAMLEALREVMRRVSYWTSGADLTAMHGIPL* |
| Ga0137360_103063731 | 3300012361 | Vadose Zone Soil | VHLREEGVRLGKHLAMLEALREVMRRVSYWTSGADLTAMHGIPL* |
| Ga0137390_111133691 | 3300012363 | Vadose Zone Soil | IHVHLREEGVRLGKHLAMLEALREVMRRVSYWTSGADLTAMHGIPL* |
| Ga0134034_12078661 | 3300012375 | Grasslands Soil | PLQVHLREEGARRGKHRAMLEALREGMRRVAYGTSGADLHAMHGIPL* |
| Ga0134029_10152472 | 3300012377 | Grasslands Soil | EEGARLGKHRAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0134036_12353391 | 3300012384 | Grasslands Soil | STPLQVHLREEGARRGKHLAMLEALREGMRRVAYWTSGADLHAMHGIPL* |
| Ga0134030_11785001 | 3300012387 | Grasslands Soil | VHLREEGARLGKHLAMLEALREVMRRVAYGTSGADLKAMYGIPL* |
| Ga0134035_10438011 | 3300012391 | Grasslands Soil | EHYPSTPLQVHLREEGARRGKHRAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0134051_12845551 | 3300012398 | Grasslands Soil | HYPSTTLQLHLREEGARLGKHLAMLEALREVMRRVAYWTSGADMNAMHGIPL* |
| Ga0134041_14238741 | 3300012405 | Grasslands Soil | PECLCIHVHLRDEGVRLGKHLAMLEALREVMRRVSYWTSGADLTAMHSIPL* |
| Ga0134050_13744632 | 3300012407 | Grasslands Soil | GKHRAMLEALREVMRRVASGTSGADLHAMHGIPL* |
| Ga0134060_12926141 | 3300012410 | Grasslands Soil | VHLREEGARLGKHRAMLEALREVMRRVAYGTSGADLHAMHGIPL* |
| Ga0150984_1007637401 | 3300012469 | Avena Fatua Rhizosphere | RLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL* |
| Ga0137396_103645392 | 3300012918 | Vadose Zone Soil | GKHLAMLEALREVMRRVSYWTSGADLTAMHGIPL* |
| Ga0137407_104446772 | 3300012930 | Vadose Zone Soil | VPLREEGVRLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL* |
| Ga0126375_107186751 | 3300012948 | Tropical Forest Soil | VHLREEGARLGKHLAMLEALREVRRRVSYWTSGADLTAMHGIPL* |
| Ga0126369_113615662 | 3300012971 | Tropical Forest Soil | VHLREEGVRLGKHLAMLEALREVRRRVADWTSGADLTAMHGIPL* |
| Ga0126369_131402801 | 3300012971 | Tropical Forest Soil | LYNAPECLGIHVHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL* |
| Ga0163162_116921961 | 3300013306 | Switchgrass Rhizosphere | GARLGKHLAMLEVLREVMRRVAYGTSGADLKAMHGIPL* |
| Ga0157379_112837772 | 3300014968 | Switchgrass Rhizosphere | VHLREEGARLEKHLAMLEVLREVMRRVAYGTSGANLKAMHGIPL* |
| Ga0182036_100858651 | 3300016270 | Soil | NAPACLCIHVPLREEGARLGKHLAMLEALREVMRRVSYWTSGADLPAMHGIPL |
| Ga0182034_108546511 | 3300016371 | Soil | VHLREEGVRLGKHLAMLEALREVRRRVAYGTSGADLPTMHGIPL |
| Ga0134083_102838411 | 3300017659 | Grasslands Soil | VHLREEGARLGKHLAMLEALREVMRRVAYGTSGADLHAMHGIHL |
| Ga0066669_107536902 | 3300018482 | Grasslands Soil | VHLREEGVRLGKHLAMLEALREVRRRVAYWTSGADLTAMHGIPL |
| Ga0179585_10982271 | 3300021307 | Vadose Zone Soil | IHVHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL |
| Ga0126371_125851111 | 3300021560 | Tropical Forest Soil | VHLREEGAKLGKHLAMLEALREVRRRGAYWTSGADLTAMHGIPL |
| Ga0242665_102760101 | 3300022724 | Soil | APECLVIHVHLREEGVRRGKHRSMLEALREVMRRVSYWTSGADLPAMHGIPL |
| Ga0242665_103262161 | 3300022724 | Soil | PECLCIHVPLREEGARRGKHLAMLEALREVRRRVAYWTSGADLHAMHGIPL |
| Ga0207670_104295321 | 3300025936 | Switchgrass Rhizosphere | IHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL |
| Ga0207668_108342742 | 3300025972 | Switchgrass Rhizosphere | MGALPLSNAPECLCIHVHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMYGIPL |
| Ga0207674_111066731 | 3300026116 | Corn Rhizosphere | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLKAIHGIPL |
| Ga0207675_1000744157 | 3300026118 | Switchgrass Rhizosphere | MGALPLSNAPECLCIHVPLREEGARLGKHLAMLEALREVMRRVAYWTSGADLNAMHGIPH |
| Ga0209814_100558691 | 3300027873 | Populus Rhizosphere | VHLRKEGARLGKHLAMLEVLREVMRRVAYGTSGADLKAMHGIPL |
| Ga0268265_123087421 | 3300028380 | Switchgrass Rhizosphere | MGALPLSNAPECLCIHVHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLKAIHG |
| Ga0137415_101949414 | 3300028536 | Vadose Zone Soil | VHLREEGVRLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL |
| Ga0308200_11366161 | 3300030905 | Soil | ECLCIHGHMREEGARLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL |
| Ga0308196_10499161 | 3300030989 | Soil | VHLREEGARLGKHLAMLEALREVIRRVAYWTSGADLHAMHGIPL |
| Ga0308189_103087901 | 3300031058 | Soil | VHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL |
| Ga0308192_10867011 | 3300031082 | Soil | VHLREEGARLGKHLAMLEALREVRRRVAYWTSGADLHAMHGIPL |
| Ga0308199_11499601 | 3300031094 | Soil | LREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL |
| Ga0308188_10296172 | 3300031097 | Soil | VPLREEGVRLGKHLAMLEALREVMRRVAYWTSGADLTAMHGIPL |
| Ga0310909_111493741 | 3300031947 | Soil | VHLREEGVRLGKHLAMLEALREVRRRVAYGTSGADLPAMHGIPL |
| Ga0306926_118225111 | 3300031954 | Soil | VHLREEGVRLGKHLAMLEALREVRRRVAYGTSGADLPAMLGIPL |
| Ga0247829_113206062 | 3300033550 | Soil | VHLRKEGARLGKHLAMLEALREVRRRVADWISGADLHAMHGISL |
| Ga0314789_018237_407_541 | 3300034480 | Soil | VHLREEGARLGKHLAMLEALREVRRRVADWISGADLHAMHGISL |
| Ga0314780_106132_415_549 | 3300034659 | Soil | VPLRKEGARRGKHLAMLEALREVRRRVADWISGADLHAMHGISL |
| Ga0314780_142891_3_158 | 3300034659 | Soil | PACLCIHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL |
| Ga0314781_152569_385_501 | 3300034660 | Soil | GARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL |
| Ga0314782_183783_424_531 | 3300034661 | Soil | LGKHLAMLEVLREVMRRVAYGTSGADLKAMHGFPL |
| Ga0314783_094650_86_220 | 3300034662 | Soil | VPLREEGARLGKHLAMLEALREVRRRVADWISGADLHAMHGISL |
| Ga0314784_034804_337_471 | 3300034663 | Soil | VHLREEGARLGKHLAMLEVLREVMRRVAYGTSGADLKAMHGIPL |
| Ga0314784_149925_1_132 | 3300034663 | Soil | HLRKEGARLGKHLAMLEALREVRRRVADWTSGADLHAMHGISL |
| Ga0314786_072036_426_608 | 3300034664 | Soil | MGALPLDNAPECLCIHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL |
| Ga0314788_136456_2_163 | 3300034666 | Soil | NAPECLCIHGHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPF |
| Ga0314788_147857_413_571 | 3300034666 | Soil | APACLCIHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL |
| Ga0314788_201053_3_122 | 3300034666 | Soil | EGARLGKHLAMLEALREVRRRVADWISGADLHAMHGISL |
| Ga0314792_181322_21_155 | 3300034667 | Soil | VHLREEGARLGKHLAMLEVLREVRRRVAYGTSGADLKAMHGIPL |
| Ga0314793_160122_373_513 | 3300034668 | Soil | IHVHLREEGARLGKHLAMLEALREVMRRVAYWTSGADLHAMHGIPL |
| Ga0314794_134889_153_287 | 3300034669 | Soil | VHLREEGARLGKHLAMLEALREVMRRVADWTSGADLHAMHGIPL |
| Ga0314796_126155_3_158 | 3300034671 | Soil | PECLCIHVHLREEGARLGKHLAMLEALREGMRRVAYWTSGADQKAIHGIPL |
| Ga0314796_129169_415_573 | 3300034671 | Soil | APACLCIHVPLRKEGARLGKHLAMLEARREVRRRVADWTSGADLHAMHGISL |
| Ga0314797_155325_4_138 | 3300034672 | Soil | VHLREEGARLGKHLAMLEALREVMRRVADWTSGADLHAMYGIPL |
| Ga0314800_042505_86_220 | 3300034675 | Soil | VHLRKEGARLGKHLAMLEALREVMRRVADWTSGADLHAMHGISL |
| Ga0314803_091372_420_584 | 3300034678 | Soil | SNAPACLCIHVPLRKEGARRGKHLAMLEALREVMRRVAYGTSGADLKAMHGIPL |
| ⦗Top⦘ |