| Basic Information | |
|---|---|
| Family ID | F098904 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MSNFLEVALASLTGITVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.41 % |
| % of genes near scaffold ends (potentially truncated) | 22.33 % |
| % of genes from short scaffolds (< 2000 bps) | 57.28 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (37.864 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.388 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.340 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.136 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.54% β-sheet: 0.00% Coil/Unstructured: 38.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 36.89 |
| PF13481 | AAA_25 | 7.77 |
| PF07659 | DUF1599 | 1.94 |
| PF13155 | Toprim_2 | 1.94 |
| PF13641 | Glyco_tranf_2_3 | 1.94 |
| PF12850 | Metallophos_2 | 0.97 |
| PF03796 | DnaB_C | 0.97 |
| PF12224 | Amidoligase_2 | 0.97 |
| PF13539 | Peptidase_M15_4 | 0.97 |
| PF02467 | Whib | 0.97 |
| PF01391 | Collagen | 0.97 |
| PF03237 | Terminase_6N | 0.97 |
| PF13578 | Methyltransf_24 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.97 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.14 % |
| Unclassified | root | N/A | 37.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000206|M3P_c10005755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1477 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1016403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1489 | Open in IMG/M |
| 3300000756|JGI12421J11937_10001061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11065 | Open in IMG/M |
| 3300000756|JGI12421J11937_10009774 | All Organisms → Viruses → Predicted Viral | 3713 | Open in IMG/M |
| 3300000756|JGI12421J11937_10157470 | Not Available | 556 | Open in IMG/M |
| 3300002408|B570J29032_108824299 | Not Available | 518 | Open in IMG/M |
| 3300002835|B570J40625_100012299 | All Organisms → cellular organisms → Bacteria | 15345 | Open in IMG/M |
| 3300002835|B570J40625_101135927 | Not Available | 658 | Open in IMG/M |
| 3300003429|JGI25914J50564_10002203 | All Organisms → cellular organisms → Bacteria | 6677 | Open in IMG/M |
| 3300003493|JGI25923J51411_1030464 | Not Available | 1043 | Open in IMG/M |
| 3300003497|JGI25925J51416_10001305 | All Organisms → cellular organisms → Bacteria | 6644 | Open in IMG/M |
| 3300004282|Ga0066599_101064838 | Not Available | 593 | Open in IMG/M |
| 3300005517|Ga0070374_10030522 | All Organisms → Viruses → Predicted Viral | 2779 | Open in IMG/M |
| 3300005527|Ga0068876_10040751 | All Organisms → Viruses → Predicted Viral | 2864 | Open in IMG/M |
| 3300005581|Ga0049081_10008874 | All Organisms → Viruses → Predicted Viral | 3816 | Open in IMG/M |
| 3300005581|Ga0049081_10246552 | Not Available | 628 | Open in IMG/M |
| 3300005662|Ga0078894_10337709 | Not Available | 1365 | Open in IMG/M |
| 3300005805|Ga0079957_1009769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7323 | Open in IMG/M |
| 3300005831|Ga0074471_11022778 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300006805|Ga0075464_10113336 | All Organisms → Viruses → Predicted Viral | 1568 | Open in IMG/M |
| 3300007538|Ga0099851_1001585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9629 | Open in IMG/M |
| 3300007545|Ga0102873_1226856 | Not Available | 560 | Open in IMG/M |
| 3300008107|Ga0114340_1006444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7382 | Open in IMG/M |
| 3300008107|Ga0114340_1019652 | All Organisms → Viruses → Predicted Viral | 3196 | Open in IMG/M |
| 3300008108|Ga0114341_10005201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40422 | Open in IMG/M |
| 3300008113|Ga0114346_1024497 | All Organisms → Viruses → Predicted Viral | 3213 | Open in IMG/M |
| 3300008116|Ga0114350_1007876 | All Organisms → Viruses → Predicted Viral | 4991 | Open in IMG/M |
| 3300008266|Ga0114363_1007789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6133 | Open in IMG/M |
| 3300008266|Ga0114363_1008067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5140 | Open in IMG/M |
| 3300008448|Ga0114876_1003383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10727 | Open in IMG/M |
| 3300008996|Ga0102831_1089621 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300009009|Ga0105105_10562610 | Not Available | 661 | Open in IMG/M |
| 3300009081|Ga0105098_10149796 | Not Available | 1047 | Open in IMG/M |
| 3300009082|Ga0105099_10375329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300009082|Ga0105099_10983845 | Not Available | 536 | Open in IMG/M |
| 3300009085|Ga0105103_10527616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 665 | Open in IMG/M |
| 3300009152|Ga0114980_10425944 | Not Available | 759 | Open in IMG/M |
| 3300009160|Ga0114981_10249730 | Not Available | 967 | Open in IMG/M |
| 3300009163|Ga0114970_10523065 | Not Available | 645 | Open in IMG/M |
| 3300009165|Ga0105102_10063372 | Not Available | 1656 | Open in IMG/M |
| 3300009165|Ga0105102_10824995 | Not Available | 530 | Open in IMG/M |
| 3300009169|Ga0105097_10322361 | Not Available | 855 | Open in IMG/M |
| 3300009180|Ga0114979_10843139 | Not Available | 512 | Open in IMG/M |
| 3300010885|Ga0133913_10005929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 31501 | Open in IMG/M |
| 3300011336|Ga0153703_1049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 38542 | Open in IMG/M |
| 3300012665|Ga0157210_1000123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40428 | Open in IMG/M |
| 3300013372|Ga0177922_10361698 | Not Available | 908 | Open in IMG/M |
| 3300017701|Ga0181364_1065056 | Not Available | 561 | Open in IMG/M |
| 3300017736|Ga0181365_1003899 | All Organisms → Viruses → Predicted Viral | 3631 | Open in IMG/M |
| 3300017754|Ga0181344_1065344 | Not Available | 1075 | Open in IMG/M |
| 3300017774|Ga0181358_1009914 | All Organisms → Viruses → Predicted Viral | 3927 | Open in IMG/M |
| 3300017774|Ga0181358_1104682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300017777|Ga0181357_1112666 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300017777|Ga0181357_1246723 | Not Available | 622 | Open in IMG/M |
| 3300017778|Ga0181349_1163046 | Not Available | 793 | Open in IMG/M |
| 3300019784|Ga0181359_1001441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6369 | Open in IMG/M |
| 3300019784|Ga0181359_1056638 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
| 3300019784|Ga0181359_1135155 | Not Available | 865 | Open in IMG/M |
| 3300020048|Ga0207193_1149598 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
| 3300020505|Ga0208088_1002196 | All Organisms → Viruses → Predicted Viral | 3131 | Open in IMG/M |
| 3300021108|Ga0214162_1008194 | All Organisms → Viruses → Predicted Viral | 1980 | Open in IMG/M |
| 3300022407|Ga0181351_1226610 | Not Available | 602 | Open in IMG/M |
| 3300023174|Ga0214921_10001552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38822 | Open in IMG/M |
| 3300023184|Ga0214919_10002303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30154 | Open in IMG/M |
| 3300023184|Ga0214919_10096020 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
| 3300023184|Ga0214919_10164544 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300023301|Ga0209414_1004006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6332 | Open in IMG/M |
| 3300025647|Ga0208160_1002988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6645 | Open in IMG/M |
| 3300027608|Ga0208974_1064397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
| 3300027644|Ga0209356_1013892 | All Organisms → Viruses → Predicted Viral | 2795 | Open in IMG/M |
| 3300027659|Ga0208975_1073574 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300027659|Ga0208975_1158389 | Not Available | 628 | Open in IMG/M |
| 3300027679|Ga0209769_1027072 | All Organisms → Viruses → Predicted Viral | 1999 | Open in IMG/M |
| 3300027693|Ga0209704_1143039 | Not Available | 691 | Open in IMG/M |
| 3300027712|Ga0209499_1001143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18928 | Open in IMG/M |
| 3300027736|Ga0209190_1310741 | Not Available | 598 | Open in IMG/M |
| 3300027749|Ga0209084_1306922 | Not Available | 596 | Open in IMG/M |
| 3300027797|Ga0209107_10000961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16331 | Open in IMG/M |
| 3300027797|Ga0209107_10038881 | All Organisms → Viruses → Predicted Viral | 2714 | Open in IMG/M |
| 3300027797|Ga0209107_10103085 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300027797|Ga0209107_10120123 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
| 3300027797|Ga0209107_10163857 | Not Available | 1126 | Open in IMG/M |
| 3300027816|Ga0209990_10127461 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300028025|Ga0247723_1003940 | Not Available | 7207 | Open in IMG/M |
| 3300028025|Ga0247723_1027147 | Not Available | 1849 | Open in IMG/M |
| 3300031787|Ga0315900_10574874 | Not Available | 832 | Open in IMG/M |
| 3300031951|Ga0315904_10004353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20275 | Open in IMG/M |
| 3300031951|Ga0315904_10027760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6658 | Open in IMG/M |
| 3300031951|Ga0315904_11130522 | Not Available | 608 | Open in IMG/M |
| 3300031963|Ga0315901_10354133 | Not Available | 1194 | Open in IMG/M |
| 3300031999|Ga0315274_11838070 | Not Available | 553 | Open in IMG/M |
| 3300032116|Ga0315903_10004411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18855 | Open in IMG/M |
| 3300033993|Ga0334994_0058830 | All Organisms → Viruses → Predicted Viral | 2369 | Open in IMG/M |
| 3300034012|Ga0334986_0055939 | All Organisms → Viruses → Predicted Viral | 2485 | Open in IMG/M |
| 3300034060|Ga0334983_0510060 | Not Available | 672 | Open in IMG/M |
| 3300034062|Ga0334995_0131457 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300034068|Ga0334990_0530398 | Not Available | 625 | Open in IMG/M |
| 3300034104|Ga0335031_0055046 | All Organisms → Viruses → Predicted Viral | 2860 | Open in IMG/M |
| 3300034106|Ga0335036_0201504 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300034107|Ga0335037_0001491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12594 | Open in IMG/M |
| 3300034283|Ga0335007_0047072 | All Organisms → cellular organisms → Bacteria | 3337 | Open in IMG/M |
| 3300034283|Ga0335007_0102010 | All Organisms → Viruses → Predicted Viral | 2124 | Open in IMG/M |
| 3300034356|Ga0335048_0544726 | Not Available | 547 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.74% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 7.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.83% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.94% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.94% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.97% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.97% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000206 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_100057553 | 3300000206 | Lotic | MSNFIQTFAASLLGITTFYLVEALYYDIKARVRGKQYTLYLEELEEELER* |
| LV_Brine_h2_0102DRAFT_10164033 | 3300000405 | Hypersaline | MSNFLETTLAATIGVTVFYLLESIYYDIKARIRGRQYEDLWDFVEEELED* |
| JGI12421J11937_100010613 | 3300000756 | Freshwater And Sediment | MSNFLQVALASLTGITVFYVLEALYYEVKARIRGKQYTDWLEQIEEERKK* |
| JGI12421J11937_100097742 | 3300000756 | Freshwater And Sediment | MSNLLETFVAALAGISTFYLLEAVYYDIKARIRGKQYTQWLEELEEDAFE* |
| JGI12421J11937_101574702 | 3300000756 | Freshwater And Sediment | MSNFTETFLASLAGIGTFYLLEGLYYDIRARIRGRQYTLLLEELEEELEH* |
| B570J29032_1088242992 | 3300002408 | Freshwater | MSNFIVTFSAALLGIGTFYLLEAVYYDIKARVRGRQYTLFLEELEEELE* |
| B570J40625_10001229915 | 3300002835 | Freshwater | MSNFFEVALASLTGIAVFYVFEAFYYEIKARINGRQYEKFLEELEEEIQP* |
| B570J40625_1011359272 | 3300002835 | Freshwater | VSNFLEVALASLTGITVFYVLEAIYYEIKARINGKRYEQFLEYLEEEYQD* |
| JGI25914J50564_100022033 | 3300003429 | Freshwater Lake | MSNFIETFAASLLGITTFYLVEALYYDIKARVKGKQYTLYLEELEEELER* |
| JGI25923J51411_10304643 | 3300003493 | Freshwater Lake | FIETFAASLLGITTFYLVEALYYDIKARVKGKQYTLYLEELEEELER* |
| JGI25925J51416_1000130512 | 3300003497 | Freshwater Lake | MSNFIETFAASLLGITTFYLVEALYYDIKARVXGKQYTLYLEELXEELER* |
| Ga0066599_1010648382 | 3300004282 | Freshwater | MSNFLETFLASLAGITVFYVLEALFYTAKAHIRGKQYENFWDDLEEELQE* |
| Ga0070374_100305223 | 3300005517 | Freshwater Lake | MSNFLQVALASLTGITVFYVLEAAYYEIKARIRGREYTLWLEELEEEKER* |
| Ga0068876_100407515 | 3300005527 | Freshwater Lake | MSNFLETFLASIAGITTFYLLEAIYYDIQARIRGRQYENFWDNLEEELQN* |
| Ga0049081_100088743 | 3300005581 | Freshwater Lentic | MSNFLQVALASLTGITVFYVLEAAYYDIKARIRGREYTLWLEELEEEKER* |
| Ga0049081_102465523 | 3300005581 | Freshwater Lentic | MSNFFEVALSSLTGIAVFYVFEAFYYEIKARINGRQYEKFLEELEEEIQP* |
| Ga0078894_103377093 | 3300005662 | Freshwater Lake | MSNFLEVALASLTGITVFYVLEAVYYDIKARIRGKQYIEWLEELEEEHQK* |
| Ga0079957_100976910 | 3300005805 | Lake | MSNFLEVALASLTGITVFYVLEAIYYEIKARINGKRYEQFLEYIEEEYQD* |
| Ga0074471_110227783 | 3300005831 | Sediment (Intertidal) | MSNFIETFAASLLGITTFYLVEALYYDIKARVRGKQYTLYLEELEEELER* |
| Ga0075464_101133361 | 3300006805 | Aqueous | MSNFTETFLASLAGIGVFYLLEALYYDIKARIRGRQYTLWLEELEEELEQ* |
| Ga0099851_100158513 | 3300007538 | Aqueous | MSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK* |
| Ga0102873_12268562 | 3300007545 | Estuarine | MSNFFETFAASLLGITTFYLVEALYYDIKARIRGKQYTLYLEELEEELDEEL |
| Ga0114340_10064444 | 3300008107 | Freshwater, Plankton | MSNFLETFLATLAGIASFYLLEAVYYDIKARIRGREYEFFMEELEENLQR* |
| Ga0114340_10196525 | 3300008107 | Freshwater, Plankton | MSNFTETFLASLAGIGSFYLLEALYYDIRSRIRGRQYTLWLEELEEELEK* |
| Ga0114341_100052011 | 3300008108 | Freshwater, Plankton | IYNILYLRSTMSNFLETFLASIAGITTFYLLEAIYYDIQARIRGRQYENFWDNLEEELQN |
| Ga0114346_10244971 | 3300008113 | Freshwater, Plankton | NILYLRSTMSNFLETFLASLAGIATFYLVEAVYYDIKARIAGKQYENFWDNLEEELQE* |
| Ga0114350_10078769 | 3300008116 | Freshwater, Plankton | PYILFIYNILYLRSTMSNFLETFLASIAGITTFYLLEAIYYDIQARIRGRQYENFWDNLEEELQN* |
| Ga0114363_10077891 | 3300008266 | Freshwater, Plankton | MSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEEVQN* |
| Ga0114363_10080679 | 3300008266 | Freshwater, Plankton | LRSTMSNFLETFLASIAGITTFYLLEAIYYDIQARIRGRQYENFWDNLEEELQN* |
| Ga0114876_100338314 | 3300008448 | Freshwater Lake | RSTMSNFLETFLASIAGITTFYLLEAIYYDIQARIRGRQYENFWDNLEEELQN* |
| Ga0102831_10896214 | 3300008996 | Estuarine | NFIETFAASLLGITTFYLVEALYYDIKARVRGKQYTLYLEELEEELER* |
| Ga0105105_105626102 | 3300009009 | Freshwater Sediment | MSNFLEVALGSLTGITVFYVLEALYYEVKARIHGRQYEKFLEELEEEIQP* |
| Ga0105098_101497963 | 3300009081 | Freshwater Sediment | MSNFLEVALASFTGITVFYLLEGLYYEVKARIRGKQYTDWLDELEEELQP* |
| Ga0105099_103753291 | 3300009082 | Freshwater Sediment | MSNFLETFLASIAGITTFYLLEAIYYDIQARIRGKQYENFWDNLEEELQE* |
| Ga0105099_109838452 | 3300009082 | Freshwater Sediment | MSNFLETFLASLAGIGTFYLIEAVYYEIKARIRGREYTNFLESLEEELQD* |
| Ga0105103_105276163 | 3300009085 | Freshwater Sediment | MSNFIEAALGSLVGIIVFFALEAVYYDIKARIRGKQYTNWLDEAEEELQP* |
| Ga0114980_104259443 | 3300009152 | Freshwater Lake | MSNFFEVALSSFVGITVFYLLEAIYYDITARIRGKQYERFFEELEEEFED* |
| Ga0114981_102497303 | 3300009160 | Freshwater Lake | NIYYTYLRSTMSNFFEVALSSFVGITVFYLLEAIYYDITARIRGKQYERFFEELEEEFED |
| Ga0114970_105230652 | 3300009163 | Freshwater Lake | MSNFLEVALASLTGITVFYVLEALYYEVKARIRGKQYTDWLEQLEEEHQK* |
| Ga0105102_100633725 | 3300009165 | Freshwater Sediment | MSNFLEVALGSLTGITVFYVLEALYYEVKARIRGKQYTDWLEELEEEHQK* |
| Ga0105102_108249952 | 3300009165 | Freshwater Sediment | MSNFLETFVATLAGITAFYALEAAYYDIKARIRGKQYTLWLEELEEEYER* |
| Ga0105097_103223613 | 3300009169 | Freshwater Sediment | MSNLLETFLASLAGITVFYLLEALYYEVKSRILGKQYTDYMDYLEEESQK* |
| Ga0114979_108431392 | 3300009180 | Freshwater Lake | MSNFLEVALASLVGITVFYALEAAYYDIKARIRGKQYTEWLDSLEEDSL |
| Ga0133913_1000592939 | 3300010885 | Freshwater Lake | MSNFLEVALASLVGITVFYALEAAYYDIKARIRGKQYTEWLDSLEEDSLD* |
| Ga0153703_104938 | 3300011336 | Freshwater | MSNFLEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEEYER* |
| Ga0157210_100012347 | 3300012665 | Freshwater | MSNFFETFAASLLGIGAFYLVEAVYYDIKARIRGKQYTLFLEELEEELEH* |
| Ga0177922_103616981 | 3300013372 | Freshwater | MSNFLEIALASLTGIVVFYGLEAVYYDIKARIRGRQYRLWLEELEEEDER* |
| Ga0181364_10650563 | 3300017701 | Freshwater Lake | MSNFIETFAASLLGITTFYLVEALYYDIKARVKGKQYTLYLEELEEEL |
| Ga0181365_10038997 | 3300017736 | Freshwater Lake | MINFLETFLASLAGITTFYLLEAVYYDIKARIRGKQYTQWLEELEEDAFE |
| Ga0181344_10653443 | 3300017754 | Freshwater Lake | MSNFLEVALGSLTGITVFYFLEALYYEVKARIRGKQYTDWLEELEEEHQK |
| Ga0181358_10099143 | 3300017774 | Freshwater Lake | MSTFLETFLASLAGITTFYLAEAAYYDIKARIRGKQYTLYLEELEEELER |
| Ga0181358_11046823 | 3300017774 | Freshwater Lake | MLNFLQVALASLTGITVFYVLEAAYYEIKARIRGR |
| Ga0181357_11126663 | 3300017777 | Freshwater Lake | MSNFLQVALASLTGITVFYVLEAAYYEIKARIRGREYTLWLEELEE |
| Ga0181357_12467231 | 3300017777 | Freshwater Lake | MLNFLQVALASLTGITVFYVFEAAYYDIKARIRGRDY |
| Ga0181349_11630463 | 3300017778 | Freshwater Lake | MSNFLQVALASLTGITVFYVFEAAYYDIKARIRGRDYTLLLEELEEEKER |
| Ga0181359_10014418 | 3300019784 | Freshwater Lake | MSNFLQVALASLTGITVFYVLEAAYYEIKARIRGREYTLWLEELEEEKER |
| Ga0181359_10566383 | 3300019784 | Freshwater Lake | MSNFIETFAASLLGITTFYLVEALYYDIKARVKGKQYTLYLEELEEELER |
| Ga0181359_11351551 | 3300019784 | Freshwater Lake | MLNFLQVALASLTGITVFYVFEAAYYDIKARIRGRDYTLLLEELEEEKER |
| Ga0207193_11495985 | 3300020048 | Freshwater Lake Sediment | MSNFLEAALGSFVGIIVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK |
| Ga0208088_10021965 | 3300020505 | Freshwater | MSNFFEVALASLTGIAVFYVFEAFYYEIKARINGRQYEKFLEELEEEIQP |
| Ga0214162_10081941 | 3300021108 | Freshwater | MSNFIVTFSAALLGIGTFYLLEAVYYDIKARVRGRQYTLFLEELEEELE |
| Ga0181351_12266101 | 3300022407 | Freshwater Lake | MSNFLEVALGSLTGITVFYVLEALYYEVKARIHGRQYEKFLEELEEEIQP |
| Ga0214921_1000155221 | 3300023174 | Freshwater | MSNFLEAALGSLAGITVFYVLEALYYEVKARIRGKQYTDWLDELEEELQP |
| Ga0214919_1000230324 | 3300023184 | Freshwater | MSNFFEVALSSFVGITVFYLLEAIYYDITARILGKQYERFFEELEEEFED |
| Ga0214919_100960203 | 3300023184 | Freshwater | MSNFTETFLASLAGIGTFYLLEALYYDIKARIRGRQYTLWLEELEEELEH |
| Ga0214919_101645441 | 3300023184 | Freshwater | MSNFLETFLASLAGIGVFYLLEALYYDIKARIRGRQYTLWLEELEEELED |
| Ga0209414_100400614 | 3300023301 | Hypersaline | MSNFLETTLAATIGVTVFYLLESIYYDIKARIRGRQYEDLWDFVEEELED |
| Ga0208160_100298810 | 3300025647 | Aqueous | MSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK |
| Ga0208974_10643973 | 3300027608 | Freshwater Lentic | MSNFLQVALASLTGITVFYVLEAAYYDIKARIRGREYTLWLEELEEEKER |
| Ga0209356_10138925 | 3300027644 | Freshwater Lake | TMSNFLQVALASLTGITVFYVLEAAYYEIKARIRGREYTLWLEELEEEKER |
| Ga0208975_10735743 | 3300027659 | Freshwater Lentic | MSNFLQVALASLTGITVFYVLEALYYEVKARIRGKQYTDWL |
| Ga0208975_11583892 | 3300027659 | Freshwater Lentic | MSNFFEVALSSLTGIAVFYVFEAFYYEIKARINGRQYEKFLEELEEEIQP |
| Ga0209769_10270721 | 3300027679 | Freshwater Lake | MSNFIETFAASLLGITTFYLVEALYYDIKARVRGKQYTLYLEELEEE |
| Ga0209704_11430391 | 3300027693 | Freshwater Sediment | MSNFLETFVATLAGITAFYALEAAYYDIKARIRGKQYTLWLEELEEEYER |
| Ga0209499_100114324 | 3300027712 | Freshwater Lake | MSNFLETFLASLAGIATFYLVEAVYYDIKARIRGREYTLWLEELEEEIQD |
| Ga0209190_13107411 | 3300027736 | Freshwater Lake | MSNFLEVALASLTGITVFYVLEALYYEVKARIRGKQYTDWLEQLEEEHQK |
| Ga0209084_13069221 | 3300027749 | Freshwater Lake | TMSTFLETFLASLAGITAFYLLEAVYYDIKARIRGKQYTLYLEELEEELER |
| Ga0209107_100009614 | 3300027797 | Freshwater And Sediment | MSNFLQVALASLTGITVFYVLEALYYEVKARIRGKQYTDWLEQIEEERKK |
| Ga0209107_100388812 | 3300027797 | Freshwater And Sediment | MSNFIQTFAASLLGITTFYLVEALYYDIKARVRGKQYTLYLEELEEELER |
| Ga0209107_101030852 | 3300027797 | Freshwater And Sediment | MSNFTETFLASLAGIGTFYLLEGLYYDIRARIRGRQYTLLLEELEEELEH |
| Ga0209107_101201231 | 3300027797 | Freshwater And Sediment | MSNLLETFVAALAGITTFYLLEAVYYDIKARIRGKQYVRWLEELEDEAQE |
| Ga0209107_101638572 | 3300027797 | Freshwater And Sediment | MSNLLETFVAALAGISTFYLLEAVYYDIKARIRGKQYTQWLEELEEDAFE |
| Ga0209990_101274613 | 3300027816 | Freshwater Lake | MSNFLETFLASIAGITTFYLLEAIYYDIQARIRGRQYENFWDNLEEELQN |
| Ga0247723_10039401 | 3300028025 | Deep Subsurface Sediment | MSNFLEVALASLTGITVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK |
| Ga0247723_10271471 | 3300028025 | Deep Subsurface Sediment | YKTILYRGVTMSTFLQTFVASLAGITTFYLLEALYYDIKARIRGKQYTQWLEDLEDDLQD |
| Ga0315900_105748742 | 3300031787 | Freshwater | MSNFLETFLATLAGIASFYLLEAVYYDIKARIRGREYEFFMEELEENLQR |
| Ga0315904_1000435327 | 3300031951 | Freshwater | LRSTMSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK |
| Ga0315904_1002776012 | 3300031951 | Freshwater | MSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEEVQN |
| Ga0315904_111305221 | 3300031951 | Freshwater | MSNFLEAAVGSFVGIIVFYALEAAYYDIKARIRGKQYTLWLEELEEELEK |
| Ga0315901_103541334 | 3300031963 | Freshwater | LYLRSTMSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEEVQN |
| Ga0315274_118380702 | 3300031999 | Sediment | MSNFLQVALASLTGITVFYVLEAAYYEIKARIRGKEYTLWLEELEEENER |
| Ga0315903_1000441128 | 3300032116 | Freshwater | LRSTMSNFIEAALGSLVGITVFYALEAAYYDIKARIRGKQYTLWLEELEEEVQN |
| Ga0334994_0058830_425_577 | 3300033993 | Freshwater | VSNFLEVALASLTGITVFYVLEAIYYEIKARINGKRYEQFLEYLEEEYQD |
| Ga0334986_0055939_539_691 | 3300034012 | Freshwater | MSNFLEAALGSLVGIIVFFALEAAYYDIKARIRGKQYTLWLEELEEEYER |
| Ga0334983_0510060_16_168 | 3300034060 | Freshwater | MSNFLEVALGSLTGITVFYVLEALYYEVKARIRGKQYTDWLDELEEELQP |
| Ga0334995_0131457_873_1025 | 3300034062 | Freshwater | MSNFLEAALGSFVGIIVFFALEAAYYDIKARIRGKQYTLWLEELEEEYER |
| Ga0334990_0530398_486_623 | 3300034068 | Freshwater | MSNFFEVALASLTGIAVFYVFEAFYYEIKARINGRQYEKFLEELEE |
| Ga0335031_0055046_2062_2214 | 3300034104 | Freshwater | MSNFLETFLASIAGITTFYLLEAIYYDIRARIRGRQYENFWDNIEEELQN |
| Ga0335036_0201504_773_925 | 3300034106 | Freshwater | MSNFIEVALASLTGITVFYLLEGLYYEVKARIRGKQYTDWLEELEEEYQR |
| Ga0335037_0001491_3082_3234 | 3300034107 | Freshwater | MSNFLEVALASLTGIVVFYALEAAYYDVKARIRGKQYERFLEDLEEEYQE |
| Ga0335007_0047072_2269_2421 | 3300034283 | Freshwater | MSNFLEVALASLTGIVVFYALEAAYYDVKARIRGRQYTLWLEELEEEHER |
| Ga0335007_0102010_1086_1238 | 3300034283 | Freshwater | MSTFLETFLASLAGIATFYLAEAVYYDIKARIRGRQYTLYLEELEEELEQ |
| Ga0335048_0544726_190_342 | 3300034356 | Freshwater | MSNFLEVALASLTGITVFYVLEAIYYEIKARINGKRYEQFLEYLEEEYQD |
| ⦗Top⦘ |