NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098883

Metagenome Family F098883

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098883
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 45 residues
Representative Sequence MRLLKLAAFLSLWVVFFALVAIVHLWISVLGLPNRWKIISRLNR
Number of Associated Samples 92
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.17 %
% of genes near scaffold ends (potentially truncated) 99.03 %
% of genes from short scaffolds (< 2000 bps) 96.12 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.291 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.738 % of family members)
Environment Ontology (ENVO) Unclassified
(33.010 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.515 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.17%    β-sheet: 0.00%    Coil/Unstructured: 45.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13444Acetyltransf_5 34.95
PF00378ECH_1 7.77
PF00158Sigma54_activat 2.91
PF01553Acyltransferase 2.91
PF02502LacAB_rpiB 0.97
PF02954HTH_8 0.97
PF05977MFS_3 0.97
PF00903Glyoxalase 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.97
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.29 %
UnclassifiedrootN/A9.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_13679183All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_103940128Not Available520Open in IMG/M
3300000953|JGI11615J12901_12004504All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300002503|C687J35164_10184672All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300004019|Ga0055439_10312334All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300004022|Ga0055432_10255470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300004463|Ga0063356_100114136All Organisms → cellular organisms → Bacteria2976Open in IMG/M
3300004463|Ga0063356_104481600All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300004778|Ga0062383_10614379All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005093|Ga0062594_102723177All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005343|Ga0070687_100700890All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300005365|Ga0070688_100594191All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300005366|Ga0070659_101452038All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005441|Ga0070700_101409038All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005457|Ga0070662_100289460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1328Open in IMG/M
3300005459|Ga0068867_101713242Not Available589Open in IMG/M
3300005467|Ga0070706_101511889All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005530|Ga0070679_101944074All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005547|Ga0070693_100440240All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300005564|Ga0070664_101136817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium736Open in IMG/M
3300005617|Ga0068859_102502540Not Available568Open in IMG/M
3300005617|Ga0068859_102799998All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005719|Ga0068861_100473375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1127Open in IMG/M
3300006806|Ga0079220_11719494All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006844|Ga0075428_102218363All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006847|Ga0075431_100851319All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300006853|Ga0075420_100611595All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300006854|Ga0075425_102837943All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006903|Ga0075426_10180992All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300006904|Ga0075424_102663808All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009012|Ga0066710_100484940All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300009100|Ga0075418_10346944All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300009553|Ga0105249_10029352All Organisms → cellular organisms → Bacteria4966Open in IMG/M
3300009810|Ga0105088_1108785All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010304|Ga0134088_10033920All Organisms → cellular organisms → Bacteria2310Open in IMG/M
3300010361|Ga0126378_10342222All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300010397|Ga0134124_12889114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300010401|Ga0134121_11653548All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300011119|Ga0105246_10605136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium948Open in IMG/M
3300011444|Ga0137463_1098197All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300011445|Ga0137427_10133641All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300012022|Ga0120191_10053666All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012174|Ga0137338_1098004All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300012202|Ga0137363_10225067All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300012212|Ga0150985_104796510All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300012228|Ga0137459_1013598All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300012493|Ga0157355_1026009All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012508|Ga0157315_1016345Not Available734Open in IMG/M
3300012582|Ga0137358_10378166All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300012914|Ga0157297_10111575All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300012987|Ga0164307_11338500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300013308|Ga0157375_11733143All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300013308|Ga0157375_12282127All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300014150|Ga0134081_10181284All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300014745|Ga0157377_10393956All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300015201|Ga0173478_10438924Not Available637Open in IMG/M
3300015372|Ga0132256_101370628All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300015372|Ga0132256_101639450All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300015372|Ga0132256_103090979All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300015373|Ga0132257_101098257All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300015373|Ga0132257_103610477All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300015374|Ga0132255_102069083All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300015374|Ga0132255_102548654All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300016270|Ga0182036_10666569All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300017939|Ga0187775_10043350All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300018028|Ga0184608_10164569All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300018032|Ga0187788_10026433All Organisms → cellular organisms → Bacteria1879Open in IMG/M
3300018073|Ga0184624_10057713All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300018074|Ga0184640_10309254All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300018076|Ga0184609_10400989All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300018433|Ga0066667_10560796All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300019883|Ga0193725_1105604All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300020009|Ga0193740_1063847All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300022883|Ga0247786_1046917All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300025159|Ga0209619_10223067All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300025313|Ga0209431_10972442All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300025324|Ga0209640_10265130All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300025325|Ga0209341_10290067All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300025904|Ga0207647_10619237All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300025905|Ga0207685_10137031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1093Open in IMG/M
3300025905|Ga0207685_10572282All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300025931|Ga0207644_11801412Not Available512Open in IMG/M
3300025934|Ga0207686_10870571All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300025936|Ga0207670_10742214Not Available815Open in IMG/M
3300025942|Ga0207689_11535842All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025986|Ga0207658_11426099All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300026317|Ga0209154_1047674All Organisms → cellular organisms → Bacteria1918Open in IMG/M
3300027765|Ga0209073_10378106All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300027907|Ga0207428_10772802All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300027907|Ga0207428_11028849Not Available578Open in IMG/M
3300028381|Ga0268264_12592801All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300030619|Ga0268386_10317947All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300031229|Ga0299913_12033144All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031720|Ga0307469_10541247All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300031720|Ga0307469_10573105All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300031854|Ga0310904_10888924Not Available629Open in IMG/M
3300031858|Ga0310892_11207698All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300031947|Ga0310909_10411030All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300032770|Ga0335085_11172685All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300034147|Ga0364925_0263200Not Available642Open in IMG/M
3300034147|Ga0364925_0356184All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300034150|Ga0364933_043546All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300034177|Ga0364932_0152495All Organisms → cellular organisms → Bacteria879Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.88%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.91%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.94%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.97%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.97%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0163.000077102162886013Switchgrass RhizosphereMRLLKLTAFFSLWAFFFALVATVHLWISILGLPYRWKIVSRLNR
INPhiseqgaiiFebDRAFT_10394012823300000364SoilMRWVKLAALLSLWAGFFVWVILVHLWISMLRLPNR
JGI11615J12901_1200450413300000953SoilMRLLKLAAFLSLWVMFFTLVAIVHLWISVLGLPNRWKIISRLNRNYTLLLRLILNIK
C687J35164_1018467213300002503SoilMRWLKLTAFLSLWAFFFGLVALVHLWVSILGLPNRWKIISRLARSFTLLLRLI
Ga0055439_1031233423300004019Natural And Restored WetlandsMKRLLKLATFLSLWAIFFGIVGIVHLWISVLGVPHRWRIISRVNRIYTLLLR
Ga0055432_1025547013300004022Natural And Restored WetlandsMRWAKLAAILSLWAFFFGFVALVHLWISVLGLSNRWEIVSRLTCSLTFLLR
Ga0063356_10011413653300004463Arabidopsis Thaliana RhizosphereMRLLKLAAFVSLWTFFFALVVTVHLWISILALPNRWKIIS
Ga0063356_10448160023300004463Arabidopsis Thaliana RhizosphereMRLLKLTAFISLWTFFFALVATVHLWISILALPNRWKIIS
Ga0062383_1061437923300004778Wetland SedimentMKRLLKLTAFLSLWVLFFGLVAMVHLWISILAMPNRWKIISRLN
Ga0062594_10272317723300005093SoilMRLLKLAAFLSLWVVFFALVAIVHLWISVLGLPNRWKIISRLNR
Ga0070687_10070089013300005343Switchgrass RhizosphereMRLLKFAAFLSLWVVFFVLVAILHLWISILGLPNRWKILSRLNRNYTLLLRLILN
Ga0070688_10059419113300005365Switchgrass RhizosphereMRLLKFAAFLSLWVVFFVLVAIVHLWISILGLPNRWKILSRLNRNYTL
Ga0070659_10145203823300005366Corn RhizosphereMRLLKLAAFLSLWVMFFVLVAIVHLWISVLGLPNRWKIISRLNRNYTLLLRLILN
Ga0070700_10140903823300005441Corn, Switchgrass And Miscanthus RhizosphereMRLLKFAAFLSLWVVFFVLVAIVHLWISILGLPNRWKILSRLNRNYTLLLRLILNIK
Ga0070662_10028946013300005457Corn RhizosphereMRWIKLAAFLSLWAGFFVCIALVHLWISVLGLPNRWKIISRLQHGFTFLIRII
Ga0068867_10171324213300005459Miscanthus RhizosphereMRWAKFTAIASLWAFFFAFIVLVQLWISVLRIPNRWEIISR
Ga0070706_10151188923300005467Corn, Switchgrass And Miscanthus RhizosphereMRLLKLTALLSLWAFFFGLVATVHLWISILVLPNRWKIISRLNRNFTLLLRLILN
Ga0070679_10194407423300005530Corn RhizosphereMRLLKLTAFLSLWVFFFALVGMVHLWVSVLGLPNRWKVIS
Ga0070693_10044024013300005547Corn, Switchgrass And Miscanthus RhizosphereMRLLKLTAFLSLWVFFFALVGMVHLWVSVLGLPNRWKVISRLNRNFTLLLRMI
Ga0070664_10113681723300005564Corn RhizosphereMRWLKLAALLSVWAGFFVCVALVHLWISMLGLPNRW
Ga0068859_10250254023300005617Switchgrass RhizosphereMRWVKLAAIVSLGAVFVGFIVLAHLWISALRMADRWVIISRLTCSLTFL
Ga0068859_10279999813300005617Switchgrass RhizosphereVRWFKLIAFLSLWLVFFVLVGMTHLWISVLRLPHRWK
Ga0068861_10047337523300005719Switchgrass RhizosphereMRWVKLIALLFLWAGFFVFFALVHLWISMLGLPNRW
Ga0079220_1171949423300006806Agricultural SoilMRLLKLAAFLSLWGVFFGLVAIVHLWVWVLGLPNRWKIISRLNRN
Ga0075428_10221836323300006844Populus RhizosphereMRLLKLAAFLSLWVFFFALVATVHLWISILGLPNRWKIISRLNRNFTLLLR
Ga0075431_10085131913300006847Populus RhizosphereMRLLKLTAFLSLWVFFFALVGLAHLWISILGLPNRWKIVSRLNWTYTL
Ga0075420_10061159513300006853Populus RhizosphereMRWAKLAAVVSLWTFFSCFLVLVHLWISVLRLPNRSGIISRLTRSLTFLLRVI
Ga0075425_10283794323300006854Populus RhizosphereMRLLKLAAFLSLWVVFFGLVAIVHLWISVLGLPNRWKIISRLNRNYTLLLRLILNIRV
Ga0075426_1018099213300006903Populus RhizosphereMRLLKLAAFLSLWVVFFALVTIVHLWISVLGLPNRWKI
Ga0075424_10266380813300006904Populus RhizosphereMRLLKLTAFLSLWAFFFGLVATVHLWISILALPNRWKIISRLNRNFT
Ga0066710_10048494033300009012Grasslands SoilMRLLKLTAFLSLWAVFFVLVAAVHLWVSILGLPNRWKIISRLN
Ga0075418_1034694413300009100Populus RhizosphereMRWAKLAAVVSLWTFFSCFLVLVHLWISVLRLPNRSGIISRL
Ga0105249_1002935213300009553Switchgrass RhizosphereMRLLKLAAFLSLWVVFFVLVAIVHLWISILGLPNRWKTLSRLNRNYTLLLRLI
Ga0105088_110878513300009810Groundwater SandMRLLKLTAYLSLWAFFFGLVVTVHLWISVLVLPNRWKIISRLNRNFTLLMRVI
Ga0134088_1003392043300010304Grasslands SoilMRWVKLSAFLSLWAFFFGLVALVHLWISVLRLPNRWKIISRLTR
Ga0126378_1034222213300010361Tropical Forest SoilMRLLKLAAFLSLWTVFFCLVAIVHVWVPVLSLPNSWKIISRLNRNYTLLVRLILKIK
Ga0134124_1288911423300010397Terrestrial SoilMRWLKLAALLSVWAGFFVCVALVHLWISMLGLPNRWQIISRLNRS
Ga0134121_1165354813300010401Terrestrial SoilMRLLKLAAFLSLWAVFFALVGIVHVWISVLGLPNRWKIISRLNRNYTLLL
Ga0105246_1060513613300011119Miscanthus RhizosphereMRWLKLAALLSVWAGFFVCVILVHLWISMLGLPNRWKIISRLNRSIAFLI
Ga0137463_109819723300011444SoilMRWAKLVAIVSLWTFFSCFLVLVHLWVSVLRLPNRWVIISRL
Ga0137427_1013364113300011445SoilMRLLKLTAFLSLWVFFFALVGLAHLWISILGLPNRWKIVSRL
Ga0120191_1005366623300012022TerrestrialMRLLKLAAFLSLWAFFFGLVATVHLWISILGLPNRWKIISR
Ga0137338_109800413300012174SoilMRLLKLTALFSLWGLFFALVAFVHLWISILALPNRWK
Ga0137363_1022506723300012202Vadose Zone SoilMRWVKLAALLSLWACSFVCVALVHLWISMLGLPNRWKIISRLNHSIAF
Ga0150985_10479651013300012212Avena Fatua RhizosphereMRWIKLTAFLSLWGFFFGLVAIVHLWISVLGLPNRWKIVSRLNRNFTLLLRL
Ga0137459_101359843300012228SoilMRLLKLTAFLSLWALFFGLVGLVHLWISILGLPNRWKIVS
Ga0157355_102600913300012493Unplanted SoilMRLLKFAAFLSLWVVFFVLVAIVHLWISLLGVPNRWKIFSPLNRTYTLL
Ga0157315_101634513300012508Arabidopsis RhizosphereMRWAKLVAIVSLWTFFSCFLVLVHLWVSVLRLPNRWVIISRLTRSLTLLLSSIL
Ga0137358_1037816613300012582Vadose Zone SoilMRWIKLVAILSLWVFFFGIVALAHLWISVLRLPNRWRIVSRLIRSFTLL
Ga0157297_1011157523300012914SoilMRLLKLAAFLSLWVMFFVLVAIVHLWISVLGLPNRWKI
Ga0164307_1133850013300012987SoilMRWVKLAALLSLWAGFFVCIALVHLWISVLGLPNRWKIISRLQHGFTFLIRTIL
Ga0157375_1173314323300013308Miscanthus RhizosphereMRLLKLTAFLSLWVFFFALVGMVHLWVSVLGLPNRWKVISRL
Ga0157375_1228212713300013308Miscanthus RhizosphereMRLLKLTAFLSLWTFFFALVGLVHLWISILGLPNRWKIVSRLNR
Ga0134081_1018128413300014150Grasslands SoilMRWVKLSAFLSLWAFFFGLVALVHLWISVLRLPNRWK
Ga0157377_1039395623300014745Miscanthus RhizosphereMRLLKLAAFLSLWVMFFVLVAIVHLWISVLGLPNRWKIISRLNRNYTLLLR
Ga0173478_1043892413300015201SoilMRWAKFTAIASLWAFFFAFIVLVQLWISVLRIPNRWEIISRLTCSLTFL
Ga0132256_10137062813300015372Arabidopsis RhizosphereMRLLKLAAFLSLWVVFFALVAIVHLWISVLGLPNRWKIISRLNRNY
Ga0132256_10163945013300015372Arabidopsis RhizosphereMRLLKLAAFLSLWVVFFALVSIVHLWISVLGLPNRWKIISRLNRNYTLL
Ga0132256_10309097923300015372Arabidopsis RhizosphereMRLLKLTAFLSLWVFFFALVGMVHLWVSILGLPNRWKVISRLNR
Ga0132257_10109825713300015373Arabidopsis RhizosphereMRLLKLAAFLSLWVVFFALVAIVHLWISVLGLPNRWKII
Ga0132257_10361047713300015373Arabidopsis RhizosphereMRWAKLVAIVSLWTFFSCFLVLVHLWISVLRLPNRWVIISRLTRGLT
Ga0132255_10206908323300015374Arabidopsis RhizosphereMRLLKLAAFLSLWVVFFALVTIVHLWISVLGLPNRWKIISRL
Ga0132255_10254865423300015374Arabidopsis RhizosphereMRLLKFAAFLSLWVVFFVLVAIVHLWISILGLPNRWK
Ga0182036_1066656913300016270SoilMRLLKLAAFLSLWTVFFFLVAIVHVWVSILGLPNRWKIISRLNRNYTLLVRLI
Ga0187775_1004335033300017939Tropical PeatlandMRLLKVTAFLSLWVFFFALVGLVHLWVSILGLPNRWKIVSRI
Ga0184608_1016456923300018028Groundwater SedimentMRLLKLTAFLSLWTFFFGLVALVHLWISILGLPNRWKIVSRL
Ga0187788_1002643343300018032Tropical PeatlandMRLLKVTAFLSLWVFFFALAGLVHLWVSILGLPNRWKMISRINRIYTLLLRSIL
Ga0184624_1005771333300018073Groundwater SedimentMRLLKFAAFLSLWVVFFVLVAIVHLWISIFGLTNSWKIISRIKR
Ga0184640_1030925423300018074Groundwater SedimentMRLLKLTAFLSLWVFFFALVGLVHLWISILGLPNRWKIV
Ga0184609_1040098913300018076Groundwater SedimentMRLLKLTAFLSLWVFFFGLVAMVHLWISILGLPNRWKIISRLNRNFTLLL
Ga0066667_1056079613300018433Grasslands SoilMRWVKLSAFLSLWAFFFGLVALVHLWISVLRLPNRWKIISRLTRSFT
Ga0193725_110560423300019883SoilMRWAKLVAIVSLWTFFSCFLVLVHLWVSVLRLPNRWVIISRLTRG
Ga0193740_106384713300020009SoilMRLLKLAAFLSLWAFFFGLVATVHVWISILALPNRWKIIS
Ga0247786_104691723300022883SoilMRLLKLAAFLSLWVMFFVLVAIVHLWISVLGLPNRWKIIS
Ga0209619_1022306713300025159SoilMRWLKLTAFLSLWAFFFGLVALVHLWISILGLPNRWKIISRLARS
Ga0209431_1097244223300025313SoilMRWLKLTAFLSLWAFFFGLVALVHLWVSILGLPNRWKIISRLARSFTLLLRLIL
Ga0209640_1026513033300025324SoilMRLLKLTAFLSLWVFFFALVGLAHLWISILGLPNRW
Ga0209341_1029006733300025325SoilMRWLKLTAFLSLWAFFFGLVALVHLWVSILGLPNRWKIISRLARSFTLLLRLILK
Ga0207647_1061923723300025904Corn RhizosphereMRLLKLAAFLSLWVVFFALVTIVHLWISVLGLPNRW
Ga0207685_1013703113300025905Corn, Switchgrass And Miscanthus RhizosphereMRWVKLAALLSVWAGFFVCVILVHLWISVLGLPNRWQIISRIQHSF
Ga0207685_1057228213300025905Corn, Switchgrass And Miscanthus RhizosphereMRLLKLAAFLSLWVVFFVLVVIVHLWISILGLPNRWKILSRLNRNY
Ga0207644_1180141223300025931Switchgrass RhizosphereMRWLKLAALLSVWAGFFVCVALVHLWISVLGLPNRWQI
Ga0207686_1087057113300025934Miscanthus RhizosphereMRWAKLVAIVSLWTFFSCFLVLVHLWISVLRLPNRWVIISRLTRGL
Ga0207670_1074221433300025936Switchgrass RhizosphereMRWLKLAALLSVWAGFFVCIALVHLWISVLGLPNR
Ga0207689_1153584213300025942Miscanthus RhizosphereMRLLKLTAFLSLWVFFFALVGMVHLWVSVLGLPNRWKVISR
Ga0207658_1142609923300025986Switchgrass RhizosphereMRLLKLAAFLSLWVVFFVLVAIVHLWISVLGLPNRWKIISRLNRNYTLLLRLILNI
Ga0209154_104767433300026317SoilMRWVKLSAFLSLWAFFFGLVALVHLWISVLRLPNRWKIISRLTRGF
Ga0209073_1037810623300027765Agricultural SoilMRLLKLAAFLSLWVMFFVLVAVVHLWISVLGMPNRWKIISRLN
Ga0207428_1077280223300027907Populus RhizosphereMRWAKLAAVVSLWTFFSCFLVLVHLWISVLRLPNRWG
Ga0207428_1102884923300027907Populus RhizosphereMRWAKFTAIASLWAFFFAFIVLVHLWISVLRIPNRWEII
Ga0268264_1259280113300028381Switchgrass RhizosphereMRLLKLAAFLSLWVMFFVLVAIVHLWISVLGLPNRWKVISRLNRN
Ga0268386_1031794733300030619SoilMRLLKLAAFLSLWAFFFALVALVHLWISILALPNRWKVISRL
Ga0299913_1203314423300031229SoilLAAFFSLWVCFFALVASVHLWISILDLPNRWEIISRLNRDFTI
Ga0307469_1054124713300031720Hardwood Forest SoilMRWAKLAAIVSLWTVFFGFVALVHLWISVLRLPNRWEIISRL
Ga0307469_1057310523300031720Hardwood Forest SoilMRLLKLTALLSLWAFFFGLVATVHLWISILVLPNRWKIISRLNRNFTLLLRL
Ga0310904_1088892433300031854SoilMRWLKLAALLSVWAGFFVCVALVHLWISMLGLPNRWKI
Ga0310892_1120769813300031858SoilMKRLLKLAAFLSLWVFFFGLVALVHLWISVLGMPNR
Ga0310909_1041103033300031947SoilMRLLKLAAFLSLWTVFFFLVAIVHVWVSILGLPNR
Ga0335085_1117268513300032770SoilMRLLKLTAFLSLWVFFFALVILIHLWISILGLPNRWKIVSRLNRIY
Ga0364925_0263200_505_6423300034147SedimentMRLAKFAAIVSLWTSFSGLVVLVHLWISILGLANRWAIISRLTRGF
Ga0364925_0356184_404_5503300034147SedimentMRWAKLAAIVSLWTFFSCFLVLVHLWISVLRLPNRWVIISRLTRSLTFL
Ga0364933_043546_2_1543300034150SedimentMRLLKLAAFLSLWVVFFVLVAIVHLWISILGLPNRWKILSRLNRNYTLLLR
Ga0364932_0152495_3_1313300034177SedimentMRWLKLTALFSLWGVFFALVAFVHLWISILGLPNRWKIISRLT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.