NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098870

Metagenome / Metatranscriptome Family F098870

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098870
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 123 residues
Representative Sequence MTRTLTVLALAALVVGSAMPGAAAELQPLMAGWERVFTVHWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAGGKVTNQRVAWVPGDVLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Number of Associated Samples 93
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.76 %
% of genes near scaffold ends (potentially truncated) 39.81 %
% of genes from short scaffolds (< 2000 bps) 75.73 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment
(15.534 % of family members)
Environment Ontology (ENVO) Unclassified
(25.243 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.010 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 12.18%    β-sheet: 39.10%    Coil/Unstructured: 48.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00072Response_reg 37.86
PF02735Ku 3.88
PF01590GAF 3.88
PF13186SPASM 1.94
PF11906DUF3426 0.97
PF09678Caa3_CtaG 0.97
PF07690MFS_1 0.97
PF13561adh_short_C2 0.97
PF09335SNARE_assoc 0.97
PF08402TOBE_2 0.97
PF12836HHH_3 0.97
PF12680SnoaL_2 0.97
PF04389Peptidase_M28 0.97
PF12706Lactamase_B_2 0.97
PF13185GAF_2 0.97
PF01075Glyco_transf_9 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 3.88
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.97
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.97
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.97
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2352745All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1923Open in IMG/M
3300000550|F24TB_13350353All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium505Open in IMG/M
3300000956|JGI10216J12902_108204090All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1982Open in IMG/M
3300003987|Ga0055471_10295035All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300003993|Ga0055468_10233906All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium574Open in IMG/M
3300004052|Ga0055490_10135628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300004114|Ga0062593_100705688All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium985Open in IMG/M
3300004156|Ga0062589_100521136All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1008Open in IMG/M
3300004463|Ga0063356_100608661All Organisms → cellular organisms → Bacteria → Proteobacteria1479Open in IMG/M
3300004799|Ga0058863_10579797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300005093|Ga0062594_101644930All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium668Open in IMG/M
3300005334|Ga0068869_100830019All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300005340|Ga0070689_100393307All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1170Open in IMG/M
3300005440|Ga0070705_101095496All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium651Open in IMG/M
3300005530|Ga0070679_101252917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium687Open in IMG/M
3300006049|Ga0075417_10035341All Organisms → cellular organisms → Bacteria2094Open in IMG/M
3300006049|Ga0075417_10096906All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300006844|Ga0075428_100138301All Organisms → cellular organisms → Bacteria2648Open in IMG/M
3300006844|Ga0075428_101706441All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium657Open in IMG/M
3300006845|Ga0075421_100477470All Organisms → cellular organisms → Bacteria → Proteobacteria1485Open in IMG/M
3300006852|Ga0075433_10552389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1012Open in IMG/M
3300006853|Ga0075420_100496603All Organisms → cellular organisms → Bacteria → Proteobacteria1054Open in IMG/M
3300006854|Ga0075425_102238064All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium608Open in IMG/M
3300006969|Ga0075419_10413019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria926Open in IMG/M
3300009148|Ga0105243_10461247All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1195Open in IMG/M
3300009156|Ga0111538_10907942All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1115Open in IMG/M
3300009157|Ga0105092_10021151All Organisms → cellular organisms → Bacteria3424Open in IMG/M
3300009545|Ga0105237_12328196All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium546Open in IMG/M
3300010371|Ga0134125_12937898All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300010399|Ga0134127_11876098All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium676Open in IMG/M
3300010403|Ga0134123_10465100All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1180Open in IMG/M
3300012349|Ga0137387_10259963All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1252Open in IMG/M
3300012355|Ga0137369_10050458All Organisms → cellular organisms → Bacteria → Proteobacteria3645Open in IMG/M
3300012358|Ga0137368_10610644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium692Open in IMG/M
3300012360|Ga0137375_10011765All Organisms → cellular organisms → Bacteria → Proteobacteria10356Open in IMG/M
3300012582|Ga0137358_10610448All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium732Open in IMG/M
3300012922|Ga0137394_10494386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1039Open in IMG/M
3300012923|Ga0137359_10868561All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium779Open in IMG/M
3300012929|Ga0137404_10583851All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1003Open in IMG/M
3300014265|Ga0075314_1148241All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium542Open in IMG/M
3300014271|Ga0075326_1255479All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300014272|Ga0075327_1018133All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300014873|Ga0180066_1049305All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium830Open in IMG/M
3300014884|Ga0180104_1118944All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium763Open in IMG/M
3300017997|Ga0184610_1002316All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria4317Open in IMG/M
3300018000|Ga0184604_10294965All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium572Open in IMG/M
3300018028|Ga0184608_10003916All Organisms → cellular organisms → Bacteria → Proteobacteria4664Open in IMG/M
3300018031|Ga0184634_10029653All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2155Open in IMG/M
3300018052|Ga0184638_1012381All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2917Open in IMG/M
3300018056|Ga0184623_10342750All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium670Open in IMG/M
3300018059|Ga0184615_10278737All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium934Open in IMG/M
3300018059|Ga0184615_10301330All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium893Open in IMG/M
3300018059|Ga0184615_10726984All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300018061|Ga0184619_10016583All Organisms → cellular organisms → Bacteria2983Open in IMG/M
3300018063|Ga0184637_10159955All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1388Open in IMG/M
3300018074|Ga0184640_10035427All Organisms → cellular organisms → Bacteria → Proteobacteria2005Open in IMG/M
3300018077|Ga0184633_10526196All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium570Open in IMG/M
3300018079|Ga0184627_10051490All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2128Open in IMG/M
3300018082|Ga0184639_10113471All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1434Open in IMG/M
3300018084|Ga0184629_10276456All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium881Open in IMG/M
3300018422|Ga0190265_10467729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1369Open in IMG/M
3300019233|Ga0184645_1334883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium634Open in IMG/M
3300019249|Ga0184648_1083576All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium524Open in IMG/M
3300019249|Ga0184648_1477992All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium572Open in IMG/M
3300019259|Ga0184646_1567279All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium565Open in IMG/M
3300020018|Ga0193721_1111524All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium694Open in IMG/M
3300020068|Ga0184649_1096535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1687Open in IMG/M
3300021090|Ga0210377_10005250All Organisms → cellular organisms → Bacteria10679Open in IMG/M
3300021090|Ga0210377_10031903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3755Open in IMG/M
3300022534|Ga0224452_1086440All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium953Open in IMG/M
3300025917|Ga0207660_10158208All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1746Open in IMG/M
3300025921|Ga0207652_11883605All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300025930|Ga0207701_10232946All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1611Open in IMG/M
3300026089|Ga0207648_11614794All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium609Open in IMG/M
3300027722|Ga0209819_10282189All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium573Open in IMG/M
3300027873|Ga0209814_10037390All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2013Open in IMG/M
3300027909|Ga0209382_10000053All Organisms → cellular organisms → Bacteria152063Open in IMG/M
3300027909|Ga0209382_11241716All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium759Open in IMG/M
3300028592|Ga0247822_10517349All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium946Open in IMG/M
3300028608|Ga0247819_10370289All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium820Open in IMG/M
3300028807|Ga0307305_10406471All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium615Open in IMG/M
3300028809|Ga0247824_10048995All Organisms → cellular organisms → Bacteria2184Open in IMG/M
3300028828|Ga0307312_10949614All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium570Open in IMG/M
3300030006|Ga0299907_10023177All Organisms → cellular organisms → Bacteria → Proteobacteria4710Open in IMG/M
3300030006|Ga0299907_10122784All Organisms → cellular organisms → Bacteria2139Open in IMG/M
3300030619|Ga0268386_10000163All Organisms → cellular organisms → Bacteria39714Open in IMG/M
3300030904|Ga0308198_1093540All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300031114|Ga0308187_10206938All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium690Open in IMG/M
3300031228|Ga0299914_10009816All Organisms → cellular organisms → Bacteria → Proteobacteria7293Open in IMG/M
3300031421|Ga0308194_10157221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium706Open in IMG/M
3300031421|Ga0308194_10254341All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300031424|Ga0308179_1051999All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300031548|Ga0307408_100352579All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300031716|Ga0310813_10009716All Organisms → cellular organisms → Bacteria6179Open in IMG/M
3300031858|Ga0310892_10016600All Organisms → cellular organisms → Bacteria3151Open in IMG/M
3300031949|Ga0214473_11419101All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium705Open in IMG/M
3300032002|Ga0307416_100790863All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1044Open in IMG/M
3300032013|Ga0310906_10173828All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1282Open in IMG/M
3300034178|Ga0364934_0020726All Organisms → cellular organisms → Bacteria2375Open in IMG/M
3300034178|Ga0364934_0231780All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium700Open in IMG/M
3300034661|Ga0314782_138597All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium586Open in IMG/M
3300034663|Ga0314784_167030All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300034672|Ga0314797_101312All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment15.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.77%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment6.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.91%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.94%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.97%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031424Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_235274523300000033SoilMRRTLTVLGLATIVVGAAGPVVAAELQPLMAGWERVFTVDWQAAQYRGQPAVEGYVNNISPYHTIRIRIMVESLDAGGQVTNQKIAWLSGDLLGGGRMFFQVPTAAAPSYRVRVFSYDRGELDSNFR*
F24TB_1335035323300000550SoilMRRLVIVLGLAGVVAGTASPTAAAELQPLMLGWERLFTVDWQSAQYRGKPVVEGYVTNVSPYHTTNIRVLVESLDAGGQVTGQQVAWVPGELLGGARVFFQVPAAPA
JGI10216J12902_10820409033300000956SoilMRRLLIVLGLAGVVAGTASPTAAAELQPLMLGWERLFTVDWQSAQSRGKPVVEGYVTNVSPYHTTNIRVLVESLDAGGQVTGQQVAWVPGELLGGARVFFQVPAAPAPAYRVRVFSYDR
Ga0055471_1029503513300003987Natural And Restored WetlandsMRRTLAVLWLAMLVVGAARPGAVAELQPLMAGWERGFSVSWQPGQYRGQPSVEGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVLVFSYDRVELDGNFR*
Ga0055468_1023390613300003993Natural And Restored WetlandsMMKRTLTILWFATLMAGAPLPGAAAPLEPLMVGWERLFSVSWGPGEYRGQPSVEGYVDNISPYHTSNIRILVESMDAGGQVTNQRIAWLSGDLLGGGRLFFQVPTPSAPSYRVRVFSYDRVELDGDFN*
Ga0055490_1013562813300004052Natural And Restored WetlandsMRRMSMIACLVVLMAAPAAPGMAAELEPLMAGWERLFSVTWEPGLYRGQPAVQGYVNNVSPYSTTNIRIMVESLDAGGQVTSQHIAWVPGELLGGNRLAFQVPATPAANYRVRVFSYDRLELDGGDFR*
Ga0062593_10070568813300004114SoilMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR*
Ga0062589_10052113623300004156SoilMRRTVAILWLVVIVVGVTLPVAAAELQPLMAGWERVFSVNWQPSQYRGKPAVEGYVNNISPYSTTNIRIIVDSMDAGGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRMEFDGNFR*
Ga0063356_10060866123300004463Arabidopsis Thaliana RhizosphereMKRTLTTLGLATLVLGAALPGAAAELEPLMAGWERVFSVDWQPGQYRGKPSVEGYVSNNSPYHTNNIRIIIDSLDAGGQVINQQIAWVPGDLLGGSRLFFQVPTQPAPSYRVRVFSYDRVELDGNFR*
Ga0058863_1057979713300004799Host-AssociatedLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR
Ga0062594_10164493023300005093SoilMRRTVAILWLVMIVAGVALPVAAAELQPLMAGWERVFSVNWQPSQYRGKPAVEGYVNNISPYSTTNIRIIVDSMDAGGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRMEFDGNFR*
Ga0068869_10083001913300005334Miscanthus RhizosphereMRRTVAILWLVVIVVGVTLPVAAAELQPLMAGWERVFSVNWQPSQYRGKPAVEGYVNNISPYSTTNIRIIVDNMDAAGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRMEFDGNFR*
Ga0070689_10039330713300005340Switchgrass RhizosphereMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVDNMDAAGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRM
Ga0070705_10109549613300005440Corn, Switchgrass And Miscanthus RhizosphereMSGGEGISMRRVLIILVLSAIALVPVLPTSAAEIQPQMAGWERNFTVTWEPGTYRGKPVVEGYVNNVSPYSTRSIRLLVDSLDAAGNVTNQRVEWLAGDLLGGGRLFFQVPAAPAPSYRVRVFSYDRIEVDGPMR*
Ga0070679_10125291723300005530Corn RhizosphereGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR*
Ga0075417_1003534123300006049Populus RhizosphereMRRLVIVLGLAGVVAGTASPTAAAELQPLMLGWERLFTVDWQSAQYRGKPVVEGYVTNVSPYHTTNIRVLVESLDAGGQVTGQQVAWVPGELLGGARVFFQVPAAPAPAYRVRVFSYDRLEMDGKIR*
Ga0075417_1009690613300006049Populus RhizosphereMRRALTVLGLAILAIGAAWPIAAAELQPLMAGWERVFSIDWQPGQYRGKPGIEGYLNNISPYSVTNIRLIVEGMDAGGQVINQKIAWVPGDVLGGSRLFFQVPTTPAPNYRVRVFSYDRVELDGNFR*
Ga0075428_10013830153300006844Populus RhizosphereMRRLLTAFGFVVAVVGAAMPGTAAEMQPLMAGWERLFTVAWQPAQHRGNPVVEGYVTNVSPYHTTNIRVLVESLDASGGVTSQRVAWVPGELLGGGRAFFQVPAAPAPAYRVRIFSYDRIEMDGNFR*
Ga0075428_10170644113300006844Populus RhizosphereTLTILGLVTSVVGAAWPVVAAELHPLMAGWERVFTIDWQAGQYRGQPAVEGYVNNISPYHLTKIRIIVESLDAGGQVTNQQIAWLSGDVLGGGRMFFQVPTATAPSYRVRVFSYDRGELDSNFR*
Ga0075421_10047747023300006845Populus RhizosphereMKRTLTMLGLATLVLGAALPGAAAELEPLMAGWERVFSVDWQPGQYRGKPSVEGYVSNNSPYHTNNIRIIIDSLDAGGQVINQQIAWVPGDLLGGSRLFFQVPTQPAPSYRVRVFSYDRVELDGNFR*
Ga0075433_1055238913300006852Populus RhizosphereMRRLLIVLGLAGVLAGTASPTAAAELQPLMLGWERLFTVDWQSAQYRGKPVVEGYVTNVSPYHTTNIRVLVESLDAGGQVTGQQVAWVPGELLGGARVFFQVPTAP
Ga0075420_10049660323300006853Populus RhizosphereMRRTLTILGLVTSVVGAAWPVVAAELHPLMAGWERVFTIDWQAGQYRGQPAVEGYVNNISPYHLTKIRIIVESLDAGGQVTNQQIAWLSGDVLGGGRMFFQVPTATAPSYRVRVFSYDRGELDSNFR*
Ga0075425_10223806423300006854Populus RhizosphereMRRLLIVLGLAGVLAGTASPTAAAELQPLMLGWERLFTVDWQSAQYRGKPVVEGYVTNVSPYHTTNVRVLVESLDAGGQVTGQQVAWVPGELLGGARVFFQVPAAPAPAYRVRVFSYDRLEMDGKIR*
Ga0075419_1041301933300006969Populus RhizosphereMRRALTVLGLAILAIGAAWPIAAAELQPLMAGWERVFSIDWQPGQYRGKPGIEGYLNNISPYSVTNIRLIVEGMDAGGQVINQKIAWVPGDVLGGSRLFFQV
Ga0105243_1046124713300009148Miscanthus RhizosphereALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR*
Ga0111538_1090794213300009156Populus RhizosphereLAILAIGAAWPIAAAELQPLMAGWERVFSIDWQPGQYRGKPGIEGYLNNISPYSVTNIRLIVEGMDAGGQVINQKIAWVPGDVLGGSRLFFQVPTTPAPNYRVRVFSYDRVELDGNFR*
Ga0105092_1002115123300009157Freshwater SedimentMRRTLTVLWLATLVVGAARPGAVAELQPLMAGWERVFSVSWQPGQYRGQPSVEGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVHVFSYDRVELDGNFH*
Ga0105237_1232819623300009545Corn RhizosphereMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQP
Ga0134125_1293789813300010371Terrestrial SoilVAAAELQPLMAGWERVFSVNWQPSQDRGKPAVEGYVNNISPYSTTNIRIIVDSMDAGGQVTHQQIAYLPGDLLGGGRIFFQVPTQLSPNYRVRVFSYDRMEFDGNFR*
Ga0134127_1187609823300010399Terrestrial SoilALPVAAAELQPLMAGWERVFSVNWQPSQYRGKPAVEGYVNNISPYSTTNIRIIVDNMDAAGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRMEFDGNFR*
Ga0134123_1046510033300010403Terrestrial SoilLPVAAAELQPLMAGWERVFSVNWQPSQYRGKPAVEGYVNNISPYSTTNIRIIVDSMDAGGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRMEFDGNFR*
Ga0137387_1025996323300012349Vadose Zone SoilMTRTLTVLGLAALVVGSAMPGAASELQPLMAGWERVFTVNWQPAEYRGRPAVEGYVNNVSPYHTVNLRVLIESLDTAGTVTNQQIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRVEAPSNLR*
Ga0137369_1005045853300012355Vadose Zone SoilMKRTLTMLGLAVLVVGSAMPAAAAELQPMMAGWERIFTVDWQPAEYRGKPTVEGYVNNVSPYNTRSIRVLVERLDTAGQVTNQQIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGTFR*
Ga0137368_1061064413300012358Vadose Zone SoilMKRTLTMLGLAVLVVGSAMPAAAAELQPMMAGWERIFTVDWQPAEYRGEPTVEGYVNNVSPYNTRSIRVLVERLDTAGQVTNQQIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGTFR*
Ga0137375_1001176573300012360Vadose Zone SoilMKRTLTMLGLAVLVVGSAMPAAAAELQPMMAGWERIFTVDWQPAEDRGEPTVEGYVNNVSPYNTRSIRVLVERLDTAGQVTNQQIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGTFR*
Ga0137358_1061044813300012582Vadose Zone SoilMTRVLTILALVVIVLARALPAPAAELQPLMAGWERYFTVTWQPVKYRGTPVVEGYINNVSPYSTRGIRVLVDSVDVAGHVTNQQVAWVPGDLLGGGRLFFQVPAAPSPAYRVRVFSYDRVEVESPIR*
Ga0137394_1049438623300012922Vadose Zone SoilMTRTLPVLALAALVIGSAMPGAAAELQPLNAGWERVFTVSWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDVAGKVTNQNIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR*
Ga0137359_1086856123300012923Vadose Zone SoilMTRVLTILALVVIVLARALPAPAAELQPLMAGWERYFTVTWQPVEYRGTPVVEGYINNVSPYSTRGIRVLVDSVDVAGHVTNQQVAWVPGDLLGGGRLFFQVPAAPSPAYRVRV
Ga0137404_1058385123300012929Vadose Zone SoilMTRVLTILALVVIVLAPALPAPAAELQPLMAGWERYFTVTWQPVEYRGTPVVEGYINNVSPYSTRGIRVLVDSVDVAGHVTNQQVAWVPGDLLGGGRLFFQVPAAPSPAYRVRVFSYDRVEVESPIR*
Ga0075314_114824113300014265Natural And Restored WetlandsMMKRTLTILWFATLMVGAPLPGAAAPLEPLMAGWERLFSVSWGPGEYRGQPSVEGYVDNISPYHTSNIRILVESMDAGGQVTNQQIAWLSGDLLGGGRLFFQVPTPSAPSYRVRVFSYDRVELDGDFN*
Ga0075326_125547913300014271Natural And Restored WetlandsMRRTLTVLWLAMLVVGAARPGAVAELQPLMAGWERVFSVSWQPGQYRGQPSVEGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVHVF
Ga0075327_101813333300014272Natural And Restored WetlandsMRRTLTVLWLAMLVVGAARPGAVAELQPLMAGWERVLSVSWQPGQYRGQPSVEGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVHVFSYDRVELDGNFR*
Ga0180066_104930523300014873SoilMTRTLTVLALAALVVGSAMPGATAELQPLMAGWERVFTVHWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAGGKVTNQRVAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIDLDGGNFR*
Ga0180104_111894413300014884SoilMTRTLTVLALAALVVGSAMPGTAAELQPLMAGWERVFTVNWQPTERRGRPTVEGYVNNVSPYHTANIRVLIESLDAAGKITNQHIAWVPGDVLGGGRLFFQVPTAPAPVYRVRVFSYDRIELDGNFR*
Ga0184610_100231643300017997Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLNAGWERVFTVNWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGKVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0184604_1029496513300018000Groundwater SedimentTMRGTLTVLGLAAIVVGAAWPVAAAEMQPLMAGWERVFSVDWQAGQYRGQPAVEGYVNNISPYHTTKIRILVESLDAGGQVTNQKIAWLSGDLLGGGRIFFQVPTAAAPSYRVRVFSYDRGELDGNFR
Ga0184608_1000391623300018028Groundwater SedimentMTRTLTVLALAVLVVGSAMPGAAAELQPQMAGWERVFTVNWQPAEYRGKPAVEGYVNNVSPYHTANIRVLIESLDAAGKVTNQHIAWLPGDMLGGGRLFFQVPTAPAPAYRVRVFSYDRIEMDGNFR
Ga0184634_1002965323300018031Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLMGGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGAFR
Ga0184638_101238123300018052Groundwater SedimentMTRTLTVLALAVLVVGSAMPGAAAELQPLNAGWERLFTVNWQPAEYRGKPAVEGYVNNVSPYHTANIRVLIESLDAAGKVTNQHIAWLPGDMLGGGRLFFQVPTAPAPAYRVRVFSYDRIEMDGNFR
Ga0184623_1034275013300018056Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLNAGWERVFTVNWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0184615_1027873713300018059Groundwater SedimentLVVGSAMPGAAAELQPLMAGWERVFTVSWAPAQYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQHIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0184615_1030133013300018059Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLMAGWERVFTVHWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAGGKVTNQRVAWVPGDVLGGGRLFFQVPTAPAPAYRVRVFSYDRVEVDGGNLR
Ga0184615_1072698413300018059Groundwater SedimentMTRTLTILALAALVVGSAMPGAAAELQPLMGGWERVFTVSWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIESLDAAGKITNQHVAWVPGDLLGGGRLFFQVPAAPAPAYRVRVFSYDRVEVDGGNLR
Ga0184619_1001658343300018061Groundwater SedimentMTRTLRVLALAALVVGSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGQVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEAPGNFR
Ga0184637_1015995523300018063Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLMAGWERLFTVNWQPAEYRGKPAVEGYVSNVSPYHTGNIRVLIESLDAAGKVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0184640_1003542733300018074Groundwater SedimentMTRTLTVLALAALVVGSAMAGAAAELQPLMGGREWVFTVNWQPAQYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGKVTNQHIAWVPGDLLGGGRLFFQVPTAPASAYRVRVFSYDRIELDGGNFR
Ga0184633_1052619613300018077Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLNAGWERVFTVNWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGKVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRI
Ga0184627_1005149033300018079Groundwater SedimentMTRTLTVLALAALVIGSAMPGAAAELQPLMGGWERVFTVSWQPAQHRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGKVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGAFR
Ga0184639_1011347123300018082Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLNAGWERLFTVNWEPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGKVTNQHVTWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGTFR
Ga0184629_1027645623300018084Groundwater SedimentMTRTLTVLALAALVVGSAMPGAAAELQPLNAGWERLFTVSWQPAEYRGKPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQRVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0190265_1046772943300018422SoilMKRALTILCFAILVVAAALPSAAAELQPLMAGWERVFSVNWQAGQYRGKPSVEGYVNNISPYQTTNIRIIVESMDAGGQVTNQQIAWLPGDLLGDGRLYFQVPTPPAPSYRVRVFS
Ga0184645_133488313300019233Groundwater SedimentRTMTRTLTVLALAVLVVGSAMPGAAAELQPLNAGWERLFTVNWQPAEYRGKPAVEGYVNNVSPYHTANIRVLIESLDAAGKVTNQHIAWLPGDMLGGGRLFFQVPTAPAPAYRVRVFSYDRIEMDGNFR
Ga0184648_108357613300019249Groundwater SedimentRTMTRTLTVLALAALVVGSAMPGAAAELQPLMLGWERVFTVSWQPGQYRGRPAVEGNVNNVSPYHTGNIRVLIESLDAAGTVTNQKIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIEMDGGNFR
Ga0184648_147799223300019249Groundwater SedimentWTMTRTLMVLALAALVVGSAMPGAAAELQPLNAGWERLFTVSWQPAEYRGKPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQRVAWLPGDMVGGGRLFFQVPTVPAPAYRVRIFSYDRIELDGGSFR
Ga0184646_156727923300019259Groundwater SedimentRTMTRTLTVLALAALVVGSAMPGAAAELQPLNAGWERVFTVNWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQHVAWLPGDMVGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0193721_111152413300020018SoilMTRTLRVLALAALVVGSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGQVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEA
Ga0184649_109653533300020068Groundwater SedimentTILALAALVVGSAMPGAAAELQPLMAGWERVFTVHWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAGGKVTNQRVAWVPGDVLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0210377_1000525033300021090Groundwater SedimentMTRTLTILALAALVVGSAMPGAAAEPQPLMAGWERVFTVSWAPAQYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAAGTVTNQHIAWVPGDLLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0210377_1003190343300021090Groundwater SedimentMTRTLTILALAALVVGSAMPGAAAELQPLMAGWERVFTVSWQGAQYRGRPAVEGYVNNVSPYHTVNIRVLIESLDAAGKITNQHVAWVPGDLLGGGRLFFQVPAAPAPAYRVRVFSYDRVEVDGGNLR
Ga0224452_108644013300022534Groundwater SedimentMTRTLTVLALAVLVVGSAMPGAAVELQPLNAGWERLFTVNWQPAEYRGKPAVEGYVNNVSPYHTANIRVLIESLDAAGKVTNQHIAWLPGDMLGGGRLFFQVPTAPAPAYRVRVFSYDRIEMDGNFR
Ga0207660_1015820823300025917Corn RhizosphereMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR
Ga0207652_1188360513300025921Corn RhizosphereMRRTVAILWLVMIVAGVALSVAAAELQPLMAGWERVFSVNWQPSQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR
Ga0207701_1023294623300025930Corn, Switchgrass And Miscanthus RhizosphereVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR
Ga0207648_1161479413300026089Miscanthus RhizosphereMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVDNMDAAGQVTHQQIAYLPGDLLGGGRIFFQVPTQPSPNYRVRVFSYDRMEFDGNFR
Ga0209819_1028218913300027722Freshwater SedimentMRRTLTVLWLATLVVGAARPGAVAELQPLMAGWERVFSVSWQPGQYRGQPSVEGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVHVFSYDRVELDGNFH
Ga0209814_1003739033300027873Populus RhizosphereMRRLVIVLGLAGVVAGTASPTAAAELQPLMLGWERLFTVDWQSAQYRGKPVVEGYVTNVSPYHTTNIRVLVESLDAGGQVTGQQVAWVPGELLGGARVFFQVPAAPAPAYRVRVFSYDRLEMDGKIR
Ga0209382_10000053493300027909Populus RhizosphereMRRALTVLGLAILAIGAAWPIAAAELQPLMAGWERVFSIDWQPGQYRGKPGIEGYLNNISPYSVTNIRLIVEGMDAGGQVINQKIAWVPGDVLGGSRLFFQVPTTPAPNYRVRVFSYDRVELDGNFR
Ga0209382_1124171613300027909Populus RhizosphereMKRTLTMLGLATLVLGAALPGAAAELEPLMAGWERVFSVDWQPGQYRGKPSVEGYVSNNSPYHTNNIRIIIDSLDAGGQVINQQIAWVPGDLLGGSRLFFQVPTQPAPSYRVRVFSYDRVELDGNFR
Ga0247822_1051734923300028592SoilMRRTLTILGLVTSVVGAAWPVVAAELQPLMAGWERVFTIDWQAGQYRGQPAVEGYVNNISPYHLTKIRIIVESLDTGGQVTNQQIAWLSGDVLGGGRMFFQVPTATAPSYRVRVFSYDRGELDSNFR
Ga0247819_1037028923300028608SoilMRRTLTILGLVTSVVGAAWPVVAAELHPLMAGWERVFTIDWQAGQYRGQPAVEGYVNNISPYHLTKIRIIVESLDAGGQVTNQQIAWLSGDVLGGGRMFFQVPTAPE
Ga0307305_1040647123300028807SoilLRVLALAALVVGSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGQVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEAPGNFR
Ga0247824_1004899533300028809SoilMRRTLTILGLVTSVVGAAWPVVAAELQPLMAGWERVFTIDWQAGQYRGQPAVEGYVNNISPYHLTKIRIIVESLDAGGQVTNQQIAWLSGDVLGGGRMFFQVPTATAPSYRVRVFSYDRGELDSNFR
Ga0307312_1094961413300028828SoilELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGQVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEAPGNFR
Ga0299907_1002317753300030006SoilMGRRLMILWLALLGLGAAGPGAAAGLTPLMAGWEQVFSVDWQPGQYRGKPAVEGYVNNISPYHTKNIRIMVESLDPGGRVTNQQVAWLPGDLLGGGRLFFQVPTTPAPGYRVSVFSYDRVELDGDFN
Ga0299907_1012278413300030006SoilMRRTLTVLWLATLVVGAARPGAVAELQPLMAGWERMFSVSWQPGQYRGQPSVAGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVHVFSYDRVELDGNFR
Ga0268386_10000163153300030619SoilMRRTLTVLWLATLVLGAARPGAVAELQPLMAGWERVFSVSWQPGQFRGQPSVEGYVNNISPYHTNNIRIMVESLDAGGQVTNQQVAWLPGDLLGGGRLFFQVPTAPASSYRVHVFSYDRVELDGNFR
Ga0308198_109354013300030904SoilRTLTVLALAALVVGSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGTVTNQQIAWVPGDLLGGGRLFFQVPTAQAPAYRVRVFSYDRTEAPGNFR
Ga0308187_1020693823300031114SoilSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGQVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEAPGNFR
Ga0299914_1000981663300031228SoilMRRTLTMLGFAMLLVGATGPGAAAELQPLVAGWEQVFSVDWQPGQYRGKPSVEGYLTNISPYHTNNVRIMVESLDAGGQVTDQQIAWLPGDLLGGGRLFFQVPAPPSPSYRVRVFSYDRVEQDGDFN
Ga0308194_1015722113300031421SoilTMTRTLTVLALAALVVGSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGTVTNQQIAWVPGDLLGGGRLFFQVPTAQAPAYRVRVFSYDRTEAPGNFR
Ga0308194_1025434113300031421SoilMTRTLRVLALAALVVGSAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIESLDAAGTVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEAPGNFR
Ga0308179_105199913300031424SoilCIEPCAETPASPLTGLPCSSVVLPVAAAMPGAAAELQPQMAGWERVFTVNWQPAQYRGRPAVEGYVNNVSPYHTVNIRVLIENLDAAGQVTNQQVAWVPGELLGGGRLFFQVPTVPAPAYRVRVFSYDRTEAPGNFR
Ga0307408_10035257913300031548RhizospherePSAAAELEPLMAGWERVFSVDWQPGQYRGKPSVEGYVNNVSPYHTNNIRIIVESMDAGGQVTNQQIAWLPGELLGGGRLFFQVPTPPAPSYRVRVFSYDRVELDGNFR
Ga0310813_1000971683300031716SoilMSGGEGISMRRVLIILVLSAIALVPVLPTSAAEIQPQMAGWERNFTVTWEPGTYRGKPVVEGYVNNVSPYSTRSIRLLVDSLDAAGNVTNQRVEWLAGDLLGGGRLFFQVPAAPAPSYRVRVFSYDRIEVDGPMR
Ga0310892_1001660063300031858SoilMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDTGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYR
Ga0214473_1141910113300031949SoilMTRTLTVLALAALVVGSAMPGAAAELQPLMAGWERVFTVHWQPAEYRGRPAVEGYVNNVSPYHTGNIRVLIESLDAGGKVTNQRVAWVPGDVLGGGRLFFQVPTAPAPAYRVRVFSYDRIELDGGNFR
Ga0307416_10079086323300032002RhizosphereMRRMLTTLWLATLVVGVALPSAAAELEPLMAGWERVFSVDWQPGQYRGKPSVEGYVNNVSPYHTNNIRIIVESMDAGGQVTNQQIAWLPGELLGGGRLFFQVPTPPAPSYRVRVFSYDRVELDGNFR
Ga0310906_1017382813300032013SoilMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDTGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPN
Ga0364934_0020726_67_4503300034178SedimentMRRTLTILGLVTVMLGAAGPGVGAELQPLMAGWERVFTVSWQPGQHRGKPVVEGYVTNVSPYETTQIRVLVESLDTAGQVTGQRIAWVPGDLGGGGRLFFQVPAAPAPAYRVRIFSYDRVERDGNFR
Ga0364934_0231780_9_3803300034178SedimentMVLALAALVVGSAMPGAAAELQPLNAGWERLFTVNWQPAEYRGKPAVEGYVNNVSPYHTGNIRVLIESLDTAGTVTNQRIAWLPGDMVGGGRLFFQVPTAPAPAYRVRIFSYDRIELDGGSFR
Ga0314782_138597_3_3683300034661SoilLLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPL
Ga0314784_167030_118_5013300034663SoilMRRTVALLWLALIVVGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDTGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR
Ga0314797_101312_219_5903300034672SoilSSPTFQVSPWLGTALPVAAAELQPLMAGWERVFSVDWQPGQYRGKPAVEGYVNNISPYSTTNIRIIVESMDAGGQVTHQQVAYLPGDLLGGGRLFFQVPTQPSPNYRVRVFSYDRIELDGPLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.