| Basic Information | |
|---|---|
| Family ID | F098835 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 48 residues |
| Representative Sequence | RSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 98.06 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.67% β-sheet: 8.00% Coil/Unstructured: 73.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00593 | TonB_dep_Rec | 1.94 |
| PF08843 | AbiEii | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104953073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300000550|F24TB_14899714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300001686|C688J18823_11033664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300002459|JGI24751J29686_10066110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300005175|Ga0066673_10641914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300005178|Ga0066688_10191806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300005179|Ga0066684_10841955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005180|Ga0066685_10196305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
| 3300005186|Ga0066676_10535960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300005293|Ga0065715_10188970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1399 | Open in IMG/M |
| 3300005295|Ga0065707_10976432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300005332|Ga0066388_105543321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300005438|Ga0070701_10021943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3055 | Open in IMG/M |
| 3300005450|Ga0066682_10472832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300005458|Ga0070681_10860093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300005471|Ga0070698_100110303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2717 | Open in IMG/M |
| 3300005471|Ga0070698_101613368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300005536|Ga0070697_100833038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300005540|Ga0066697_10419962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005545|Ga0070695_101369293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300005557|Ga0066704_10326844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300005558|Ga0066698_10408149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300005564|Ga0070664_100863510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300005615|Ga0070702_101684446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300005617|Ga0068859_102600558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300005713|Ga0066905_101555986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300005841|Ga0068863_101082525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300005842|Ga0068858_101552374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300006847|Ga0075431_101593566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300006852|Ga0075433_10162469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
| 3300006854|Ga0075425_101271468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300006903|Ga0075426_11117709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300007265|Ga0099794_10604431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 581 | Open in IMG/M |
| 3300009012|Ga0066710_100179686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2988 | Open in IMG/M |
| 3300009012|Ga0066710_103702735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300009012|Ga0066710_104274814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300009038|Ga0099829_11725934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300009098|Ga0105245_11568621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300009147|Ga0114129_10357520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1933 | Open in IMG/M |
| 3300009156|Ga0111538_12601906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300009162|Ga0075423_10948910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300009162|Ga0075423_12392298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300009177|Ga0105248_10650828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300009553|Ga0105249_12337421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300009792|Ga0126374_10894950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300010303|Ga0134082_10130388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300010321|Ga0134067_10065021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300010321|Ga0134067_10301345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300010359|Ga0126376_11743547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300010361|Ga0126378_12244912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300010397|Ga0134124_10773426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300010399|Ga0134127_11896040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300010401|Ga0134121_10072074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2860 | Open in IMG/M |
| 3300010403|Ga0134123_12799241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012189|Ga0137388_10587339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300012201|Ga0137365_10068739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2673 | Open in IMG/M |
| 3300012209|Ga0137379_10602841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300012359|Ga0137385_10480422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300012362|Ga0137361_10809132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300012362|Ga0137361_11682024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012363|Ga0137390_10119780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2606 | Open in IMG/M |
| 3300012469|Ga0150984_122598803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012923|Ga0137359_10788278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300012971|Ga0126369_13267096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012976|Ga0134076_10558936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012987|Ga0164307_10377554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300013297|Ga0157378_10400592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
| 3300015241|Ga0137418_10237799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300015357|Ga0134072_10280772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300015372|Ga0132256_101189041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300017656|Ga0134112_10444632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300018075|Ga0184632_10346446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300018079|Ga0184627_10029764 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
| 3300018433|Ga0066667_10752881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300018468|Ga0066662_10130912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300020003|Ga0193739_1080723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300021080|Ga0210382_10156382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300021510|Ga0222621_1144216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300025926|Ga0207659_10436485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
| 3300025941|Ga0207711_10155126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2069 | Open in IMG/M |
| 3300025941|Ga0207711_11402135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300025942|Ga0207689_11606120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300026095|Ga0207676_10156162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1971 | Open in IMG/M |
| 3300026116|Ga0207674_11043754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300026343|Ga0209159_1096155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300026532|Ga0209160_1321607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300026884|Ga0207455_1000594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300027645|Ga0209117_1154512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300027882|Ga0209590_10708970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300027882|Ga0209590_10935893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300027909|Ga0209382_10222157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2156 | Open in IMG/M |
| 3300027909|Ga0209382_11561648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300028381|Ga0268264_10413356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300028608|Ga0247819_10873759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300028710|Ga0307322_10119722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300028799|Ga0307284_10012568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2567 | Open in IMG/M |
| 3300031819|Ga0318568_10925121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300031860|Ga0318495_10158804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300031879|Ga0306919_11190793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300031912|Ga0306921_12065192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300031938|Ga0308175_101310111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300033412|Ga0310810_10653620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300034114|Ga0364938_042014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1049530731 | 3300000364 | Soil | PAGVTFNAKSGEVIAPDAVWNGLFTFLKPELFTMSSPGSR* |
| F24TB_148997141 | 3300000550 | Soil | DNGDVPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR |
| C688J18823_110336642 | 3300001686 | Soil | GDDGDLPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKTPVAASK* |
| JGI24751J29686_100661101 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | PHSIIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAAPPR* |
| Ga0066673_106419141 | 3300005175 | Soil | AGVTFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGLQ* |
| Ga0066688_101918062 | 3300005178 | Soil | TGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFPRTAKGSQ* |
| Ga0066684_108419551 | 3300005179 | Soil | RSTGIVHPAGVAFNARDGEVIAPDAIWNGLFTFLEPELFKRSAAGAR* |
| Ga0066685_101963054 | 3300005180 | Soil | SVVKGRSTGIVHPAGVTFNARNGEVIAPDAIWNGLFTFLKPELFAPAAAGAR* |
| Ga0066676_105359602 | 3300005186 | Soil | AGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRPAAGSR* |
| Ga0065715_101889701 | 3300005293 | Miscanthus Rhizosphere | PAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRSTTASR* |
| Ga0065707_109764322 | 3300005295 | Switchgrass Rhizosphere | DGDVPPRSLIKGRSTGIVHPAGVTFNARNGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ* |
| Ga0066388_1055433212 | 3300005332 | Tropical Forest Soil | SIVKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFATSAKGSP* |
| Ga0070701_100219432 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | DGDVPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPTAASR* |
| Ga0066682_104728321 | 3300005450 | Soil | STGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFAPAAAGAR* |
| Ga0070681_108600932 | 3300005458 | Corn Rhizosphere | TGIVHPAGVTFNAKSGEVIAPDAVWNGLFTFLKPELFNSGSQASR* |
| Ga0070698_1001103031 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKAPSRISR* |
| Ga0070698_1016133681 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSR* |
| Ga0070697_1008330381 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RSIVKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARTAKGSP* |
| Ga0066697_104199622 | 3300005540 | Soil | RSTGIVHPAGVTFNAKHGEVIAPDAVWNGLFTFMKPELFKETAAGTQ* |
| Ga0070695_1013692931 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFSARGR* |
| Ga0066704_103268441 | 3300005557 | Soil | DVPPRTLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGIQ* |
| Ga0066698_104081491 | 3300005558 | Soil | FNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ* |
| Ga0070664_1008635102 | 3300005564 | Corn Rhizosphere | TGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR* |
| Ga0070702_1016844461 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PHSTIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKMSAPAAR* |
| Ga0068859_1026005581 | 3300005617 | Switchgrass Rhizosphere | HSIIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAAPPR* |
| Ga0066905_1015559862 | 3300005713 | Tropical Forest Soil | NAKDGEVIAPDAVWNGLFTFLKPELFKPTAAGSR* |
| Ga0068863_1010825252 | 3300005841 | Switchgrass Rhizosphere | PHSVIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR* |
| Ga0068858_1015523741 | 3300005842 | Switchgrass Rhizosphere | HPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFSARGR* |
| Ga0075431_1015935662 | 3300006847 | Populus Rhizosphere | TFNAKSGEVIAPDAVWNGLFTFLKPELFTMSSPGSR* |
| Ga0075433_101624692 | 3300006852 | Populus Rhizosphere | PPRSLIKGRSTGIVHPAGVTFNAKHGEVIAPDAVWNGLFTFLKPELFKGTAAGTR* |
| Ga0075425_1012714682 | 3300006854 | Populus Rhizosphere | RSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKR* |
| Ga0075426_111177091 | 3300006903 | Populus Rhizosphere | HPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARNSKGSQ* |
| Ga0099794_106044312 | 3300007265 | Vadose Zone Soil | TGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAGPGTK* |
| Ga0066710_1001796862 | 3300009012 | Grasslands Soil | GRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKATATGSR |
| Ga0066710_1037027352 | 3300009012 | Grasslands Soil | FNAKDGEVIAPDAVWNGLFTFLKPELFKRPAAGSR |
| Ga0066710_1042748141 | 3300009012 | Grasslands Soil | GIVHPAGVAFNARDGEVIAPDAVWNGLFTFLEPELFKRTASGAR |
| Ga0099829_117259342 | 3300009038 | Vadose Zone Soil | DVPPRSILKGRSTGIVQPAGVAFNARDGEVIAPDAVWNGLFTFLKPELFAPTAAGSR* |
| Ga0105245_115686212 | 3300009098 | Miscanthus Rhizosphere | GIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTGAGSQ* |
| Ga0114129_103575201 | 3300009147 | Populus Rhizosphere | SLIKGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLKPELFNEAGRGRRSF* |
| Ga0111538_126019062 | 3300009156 | Populus Rhizosphere | SIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRSTTASR* |
| Ga0075423_109489102 | 3300009162 | Populus Rhizosphere | DVPPRSLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSR* |
| Ga0075423_123922982 | 3300009162 | Populus Rhizosphere | APHSMIKGRSTGIVHPAGVAFNAKNGEVIAPDAVWNGLFTFLKPELFNR* |
| Ga0105248_106508282 | 3300009177 | Switchgrass Rhizosphere | HPAGVAFNARDGEVIAPDAIWNGLFTFLKPELFAARGR* |
| Ga0105249_123374211 | 3300009553 | Switchgrass Rhizosphere | PAGVAFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSVQ* |
| Ga0126374_108949502 | 3300009792 | Tropical Forest Soil | RSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKPRAAGSQ* |
| Ga0134082_101303881 | 3300010303 | Grasslands Soil | VWDDVADDGDAPPRSLIKGRSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFREPSAQ* |
| Ga0134067_100650212 | 3300010321 | Grasslands Soil | AGVTFNARDGEVIAPDAIWNGLFTFLKPELFREPSAQ* |
| Ga0134067_103013452 | 3300010321 | Grasslands Soil | VTFNARDGEVIAPDAVWNGLFTFLKPELFARAAKGPQ* |
| Ga0126376_117435472 | 3300010359 | Tropical Forest Soil | DVPARSVVKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTMAGTQ* |
| Ga0126378_122449122 | 3300010361 | Tropical Forest Soil | KGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFVRPGPSEDHGVPAR* |
| Ga0134124_107734262 | 3300010397 | Terrestrial Soil | HPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR* |
| Ga0134127_118960402 | 3300010399 | Terrestrial Soil | SLIKGRSTGIVHPAGVAFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSIQ* |
| Ga0134121_100720741 | 3300010401 | Terrestrial Soil | GIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR* |
| Ga0134123_127992412 | 3300010403 | Terrestrial Soil | IVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR* |
| Ga0137388_105873391 | 3300012189 | Vadose Zone Soil | RSIIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFSRTAKASQ* |
| Ga0137365_100687391 | 3300012201 | Vadose Zone Soil | IKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAAAGSR* |
| Ga0137379_106028412 | 3300012209 | Vadose Zone Soil | ADDGDAPPRSLVKGRSTGIVHPAGVTFNAKHGEVIAPDAVWNGLFTFMKPELFKATAAGTQ* |
| Ga0137385_104804222 | 3300012359 | Vadose Zone Soil | PAGVTFNAKHGEVIAPDAVWNGLFTFMKPELFKATAAGTQ* |
| Ga0137361_108091323 | 3300012362 | Vadose Zone Soil | PRSIIKGRSTGIVHPAGVTFDTRDGEVIAPDAIWNGLFTFLKPELFAPAPAGRR* |
| Ga0137361_116820241 | 3300012362 | Vadose Zone Soil | TGIVHPAGVTFNAKDGEVVAPDAVWNGLFTFLKPELFKRTAPGTQ* |
| Ga0137390_101197801 | 3300012363 | Vadose Zone Soil | IVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFTRTAAGAR* |
| Ga0150984_1225988032 | 3300012469 | Avena Fatua Rhizosphere | DNGDVPPHSVIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR |
| Ga0137359_107882781 | 3300012923 | Vadose Zone Soil | KGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARAAKGPQ* |
| Ga0126369_132670962 | 3300012971 | Tropical Forest Soil | TGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFRR* |
| Ga0134076_105589362 | 3300012976 | Grasslands Soil | GVTFNAKDGEVIAPDAVWNGLFTFLKPELFRPPDSRSSR* |
| Ga0164307_103775542 | 3300012987 | Soil | VHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR* |
| Ga0157378_104005921 | 3300013297 | Miscanthus Rhizosphere | HPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR* |
| Ga0137418_102377993 | 3300015241 | Vadose Zone Soil | RSLIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARAAKGPQ* |
| Ga0134072_102807722 | 3300015357 | Grasslands Soil | TGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFREPSAQ* |
| Ga0132256_1011890412 | 3300015372 | Arabidopsis Rhizosphere | TFNARDGEVIAPDAVWNGLFTFLKPELFAPTATGSR* |
| Ga0134112_104446322 | 3300017656 | Grasslands Soil | VKGRSTGIVHPAGVTFNAKDGELIAPDAVWNGLFTFLKPELFKPTPPGTP |
| Ga0184632_103464462 | 3300018075 | Groundwater Sediment | TFNARDGEVIAPDAVWNGLFTFLKPELFKRPAAGSQ |
| Ga0184627_100297641 | 3300018079 | Groundwater Sediment | RSIIKGRSTGLVHPAGVTFNAKDGEVIAPDAIWNGLFTFLKPELFYPAVPSSR |
| Ga0066667_107528812 | 3300018433 | Grasslands Soil | VHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ |
| Ga0066662_101309122 | 3300018468 | Grasslands Soil | RSTGIVHPAGVTFNARDGELIAPDAVWNGLFTFLKPELFKPTRPGTP |
| Ga0193739_10807232 | 3300020003 | Soil | GRSTGIVHPAGVTFNARNGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ |
| Ga0210382_101563822 | 3300021080 | Groundwater Sediment | DVPPRSLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ |
| Ga0222621_11442162 | 3300021510 | Groundwater Sediment | AFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ |
| Ga0207659_104364852 | 3300025926 | Miscanthus Rhizosphere | PAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKMSSVK |
| Ga0207711_101551262 | 3300025941 | Switchgrass Rhizosphere | DGDVPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPTAASR |
| Ga0207711_114021352 | 3300025941 | Switchgrass Rhizosphere | RSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKMATGTPRAGAAQ |
| Ga0207689_116061201 | 3300025942 | Miscanthus Rhizosphere | TGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR |
| Ga0207676_101561621 | 3300026095 | Switchgrass Rhizosphere | GIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKMATGTPRAGAPQ |
| Ga0207674_110437541 | 3300026116 | Corn Rhizosphere | MGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLEPELFNR |
| Ga0209159_10961551 | 3300026343 | Soil | DEKDDGDAPPRSVVKGRSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFAPAAAGAR |
| Ga0209160_13216072 | 3300026532 | Soil | DVPPRTLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGIQ |
| Ga0207455_10005941 | 3300026884 | Soil | TFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR |
| Ga0209117_11545121 | 3300027645 | Forest Soil | TFNARDGEVIAPDAIWNGLFTFLKPELFAPAAAGPR |
| Ga0209590_107089701 | 3300027882 | Vadose Zone Soil | GVTFNARDGEVIAPDAVWNGLFTFLKPELFSRTAKASQ |
| Ga0209590_109358932 | 3300027882 | Vadose Zone Soil | IVHPAGVAFNARDGEVIAPDAIWNGLFTFLKPELFKRTTVGAR |
| Ga0209382_102221571 | 3300027909 | Populus Rhizosphere | NGDVPPRALIKGRSTGIVHPAGVTFNARNGEVIAPDAIWNGLFTFLKPELFGRTPPTGP |
| Ga0209382_115616482 | 3300027909 | Populus Rhizosphere | DVPPRSLIKGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLKPELFKPTGAGTQ |
| Ga0268264_104133561 | 3300028381 | Switchgrass Rhizosphere | GRSTGIVHPAGVAFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSVQ |
| Ga0247819_108737591 | 3300028608 | Soil | SVIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR |
| Ga0307322_101197222 | 3300028710 | Soil | DGDVAPRSLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ |
| Ga0307284_100125681 | 3300028799 | Soil | IKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ |
| Ga0318568_109251212 | 3300031819 | Soil | HPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFAGTGKGSQ |
| Ga0318495_101588042 | 3300031860 | Soil | GRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFAGTGKGSQ |
| Ga0306919_111907932 | 3300031879 | Soil | SLIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFAGTGKGSQ |
| Ga0306921_120651921 | 3300031912 | Soil | STGIVHPAGVTFNARDGEVIAPDAVWNGLFTFMKPELFRPLGAETR |
| Ga0308175_1013101112 | 3300031938 | Soil | PHSLIMGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLKPELFNR |
| Ga0310810_106536201 | 3300033412 | Soil | DEGDDGDVAPHSLIMGRSTGIVHPAGVTFNAKSGEVIAPDAVWNGLFTFLKPELFNSGSQASR |
| Ga0364938_042014_646_774 | 3300034114 | Sediment | VHPAGVTFNAKDGEVIAPDAIWNGLFTFLKPELFNPAVPQSR |
| ⦗Top⦘ |