Basic Information | |
---|---|
Family ID | F098800 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 41 residues |
Representative Sequence | MALYDDTGFVSHHDAEQALESARDYIGVIRADITARKP |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 5.56 % |
% of genes near scaffold ends (potentially truncated) | 15.53 % |
% of genes from short scaffolds (< 2000 bps) | 16.50 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (82.524 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (14.563 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.864 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.951 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF01909 | NTP_transf_2 | 4.85 |
PF00206 | Lyase_1 | 2.91 |
PF02321 | OEP | 2.91 |
PF13620 | CarboxypepD_reg | 1.94 |
PF12838 | Fer4_7 | 1.94 |
PF07927 | HicA_toxin | 1.94 |
PF08327 | AHSA1 | 0.97 |
PF13173 | AAA_14 | 0.97 |
PF02661 | Fic | 0.97 |
PF03631 | Virul_fac_BrkB | 0.97 |
PF09925 | DUF2157 | 0.97 |
PF07676 | PD40 | 0.97 |
PF12161 | HsdM_N | 0.97 |
PF10017 | Methyltransf_33 | 0.97 |
PF02687 | FtsX | 0.97 |
PF01266 | DAO | 0.97 |
PF01370 | Epimerase | 0.97 |
PF04956 | TrbC | 0.97 |
PF11154 | DUF2934 | 0.97 |
PF01180 | DHO_dh | 0.97 |
PF03459 | TOBE | 0.97 |
PF09907 | HigB_toxin | 0.97 |
PF13545 | HTH_Crp_2 | 0.97 |
PF07878 | RHH_5 | 0.97 |
PF02852 | Pyr_redox_dim | 0.97 |
PF04851 | ResIII | 0.97 |
PF00496 | SBP_bac_5 | 0.97 |
PF02604 | PhdYeFM_antitox | 0.97 |
PF00929 | RNase_T | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 5.83 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.94 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.97 |
COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.97 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.97 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.97 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.97 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.97 |
COG3838 | Type IV secretory pathway, VirB2 component (pilin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.97 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 82.52 % |
All Organisms | root | All Organisms | 17.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005340|Ga0070689_100535511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1007 | Open in IMG/M |
3300005457|Ga0070662_101670479 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006881|Ga0068865_101284539 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300009038|Ga0099829_10974267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
3300009518|Ga0116128_1050612 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300010371|Ga0134125_10410722 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300017931|Ga0187877_1063897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1627 | Open in IMG/M |
3300017972|Ga0187781_10491759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300018020|Ga0187861_10414107 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300018022|Ga0187864_10413974 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300018090|Ga0187770_10458927 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300021168|Ga0210406_10000652 | All Organisms → cellular organisms → Bacteria | 46748 | Open in IMG/M |
3300025459|Ga0208689_1034855 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300025496|Ga0208191_1100685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 588 | Open in IMG/M |
3300025501|Ga0208563_1107237 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300026023|Ga0207677_12205249 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031525|Ga0302326_13240506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300034124|Ga0370483_0095083 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 14.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.94% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.94% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.97% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.97% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.97% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033821 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-X0 | Environmental | Open in IMG/M |
3300033823 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25616J43925_103238051 | 3300002917 | Grasslands Soil | LRRKRNMALYDDTGFVSHHDAESALESARDYLDVIRADIAARRP* |
Ga0062385_112759631 | 3300004080 | Bog Forest Soil | MALHDDAGFVSHHNAEQALESTRDYLGVIRADIAARKPRRASD* |
Ga0062387_1017779992 | 3300004091 | Bog Forest Soil | LRRKRNMALYGDIGLVSHHEAEQALETARDYLGIIRAKVSARKP* |
Ga0070689_1005355111 | 3300005340 | Switchgrass Rhizosphere | VFDSFRRKRKLALYDDTAFVSHQDAEQSLEAARDYLAVICADVTARKP* |
Ga0070662_1016704791 | 3300005457 | Corn Rhizosphere | FRRKRKLALYDDTAFVSHQDAEQSLEAARDYLAVICADVTARKP* |
Ga0066704_100444775 | 3300005557 | Soil | MALYDDTGFVSHHDAEQALEAARDYLGVVRADITARKP* |
Ga0066903_1049677301 | 3300005764 | Tropical Forest Soil | RNLAPYGDIGFVSHHEAQWLEAAENYLKVIRADILTRKR* |
Ga0097691_10525001 | 3300006055 | Arctic Peat Soil | LRRKRNLALYDDTGFVSQRDAEQALESARDYLNVIRSDIAARRP* |
Ga0068865_1012845391 | 3300006881 | Miscanthus Rhizosphere | GLLTVFDSFRRKRKLALYDDTAFVSHQDAEQSLEAARDYLAVICADVTARKP* |
Ga0099829_109742672 | 3300009038 | Vadose Zone Soil | FDRLRRKRNMALYDDTGFVSHHDAEQALEAARDYLGVMRADITVRRP* |
Ga0116128_10202061 | 3300009518 | Peatland | MALYDDSGFVSHHEAEQALESAGDYLNVIRADIAARKP* |
Ga0116128_10506123 | 3300009518 | Peatland | LFDRLRRKRNVALYDDTGFVSRHEAEEALESARNFIDVIRADITARKP* |
Ga0116111_11114692 | 3300009616 | Peatland | RRKRNTALYDDTGFVSHHDAEQALESAGDYLNVIRADITGRKP* |
Ga0116127_10452853 | 3300009618 | Peatland | RNVALYDDTGFVSRHEAEEALESARNFIDVIRADITARKP* |
Ga0116125_11410772 | 3300009628 | Peatland | ALYDDTGFVSYHDAEQALESAGDYLNVIRADIVARKP* |
Ga0116120_12768561 | 3300009641 | Peatland | YDDTGFVSRHEAEEALESARNFIDVIRADITARKA* |
Ga0116134_11434181 | 3300009764 | Peatland | NTALYDDTAFVSRHDAEEAITTARDYLAVIGADIHARRPKA* |
Ga0116219_107129792 | 3300009824 | Peatlands Soil | LYDDSGFVSHHEAEQALESAGEYLNMIRADVAARKP* |
Ga0126373_114028241 | 3300010048 | Tropical Forest Soil | RLRRKRNMALYDDTGFISRQDAEQALESARQLIEVIRADVNSRKP* |
Ga0099796_105505972 | 3300010159 | Vadose Zone Soil | FDGLRRKRNLALYDDTGFISRQDAEYSLDAARDYIGVIRADIATRKP* |
Ga0134111_105012891 | 3300010329 | Grasslands Soil | RNLALYDDTGFVSHHDAEQALESARQYLDVIRADIAGRKP* |
Ga0074046_107765112 | 3300010339 | Bog Forest Soil | YDDTGFVSHHDAEQALESAGDYLNVIRADIAARKP* |
Ga0074044_100174995 | 3300010343 | Bog Forest Soil | MALYDDAGYVSRHDAEQALESAHDNLGVSRADITARKC* |
Ga0134125_104107223 | 3300010371 | Terrestrial Soil | LLTVFDSFRRKRKLALYDDTAFVSHQDAEQSLEAARDYLAVICADVTARKP* |
Ga0126381_1014698423 | 3300010376 | Tropical Forest Soil | MALYDDTGFISRQDAEQALESARQLIEVIRADVNSRKP* |
Ga0137393_100897981 | 3300011271 | Vadose Zone Soil | RKRNLALYDDTGFVSHHEAEQALQSASDYLKVIRSDIAGRKP* |
Ga0137383_104451311 | 3300012199 | Vadose Zone Soil | KRNMALYDDAGFVSRHDAEQALESARDFIGVIRADITARTPSKP* |
Ga0137362_106947011 | 3300012205 | Vadose Zone Soil | LYDDTGFVSHHDAEQALESAGDYLNVMRADITARKP* |
Ga0137362_110034251 | 3300012205 | Vadose Zone Soil | LRRKRNQALYDDTGFVSHHDAEQALEAARDYLAVVRADITARKP* |
Ga0137377_112035782 | 3300012211 | Vadose Zone Soil | KRNMALYDDAGFVSRHDAEQALESARDFIGVIRADITARAPSKP* |
Ga0137373_101680684 | 3300012532 | Vadose Zone Soil | MALYDDTGFVSHHDAEQALESAADYLNVMRADIVARKP* |
Ga0181524_104620511 | 3300014155 | Bog | TALYDDTGFVSHRDAEQALESAGEYLNVIRADIGDRKP* |
Ga0182018_100183434 | 3300014489 | Palsa | MALYDDTGFVSRCNAEQALESAREFITVIRADIDARKT* |
Ga0182018_107198662 | 3300014489 | Palsa | LRRKRNIALYDDSGFVSHRDAEEALEIASKYLGVIRTDITSRKP* |
Ga0182015_109443892 | 3300014495 | Palsa | LYDDTGFVSRHDAEQALEAAGRYLKIMRADIDARKP* |
Ga0182024_125343662 | 3300014501 | Permafrost | LYDDTGFVSRHDAEQALESAGDYLNVIRADIATRKP* |
Ga0137405_11787431 | 3300015053 | Vadose Zone Soil | RNMALYDDTGFVSHHEAEQALVSAGDYLNVIRTDIAARKP* |
Ga0134072_100873021 | 3300015357 | Grasslands Soil | LYDDTGFVSHHDAEQALEAARDYLGVVRADITARKP* |
Ga0187818_102060032 | 3300017823 | Freshwater Sediment | MALYDDTGFISHHDAEQALQSAGDYLNVIRAEIAARKP |
Ga0187818_105760241 | 3300017823 | Freshwater Sediment | YDDTGFVSHHEAEQALEVARNYLAVIRANIAARQP |
Ga0187856_10469811 | 3300017925 | Peatland | MALYDDSGFVSHHEAEQALESAGDYLNVIRADIAARKP |
Ga0187856_10747921 | 3300017925 | Peatland | RLRRKRNTALYDDTGFVSHHDAEQALESAGDYLNVIRVDIAARKP |
Ga0187849_11300491 | 3300017929 | Peatland | RNTALYDDTGFVSHHDAEQALESAGDYLNVIRADITGRKP |
Ga0187877_10638971 | 3300017931 | Peatland | VFDRLRRKRNTALYDDTGFVSHHDAEQALESAGDYLNVIRADITGRKP |
Ga0187803_101163551 | 3300017934 | Freshwater Sediment | MALYDDTGFVSHYEAEQALKAARDYLGLIRADITARRP |
Ga0187803_104428941 | 3300017934 | Freshwater Sediment | MALYDDTGFVSHQEAEQALKAARDYLAVIRADITARQP |
Ga0187854_101332151 | 3300017938 | Peatland | RNVALYDDTGFVSRHEAEEALESARNFIDVIRADITARKP |
Ga0187879_105911741 | 3300017946 | Peatland | NMALYDDTGFVSHHDAEQALESAGEYLKVIRVDIAAREP |
Ga0187817_109391092 | 3300017955 | Freshwater Sediment | RLRRKRNMALYDDAGFVSHHEAEQALKAARDYLGVIRADITARQP |
Ga0187778_102999902 | 3300017961 | Tropical Peatland | MTLYDDSGFVSYHDAEEAVRAARDYLAVIRADINARKPRCG |
Ga0187781_104917594 | 3300017972 | Tropical Peatland | LALYDDTGFVSHRDAEQALEAAGNYLNVIRADIAARKP |
Ga0187815_102853331 | 3300018001 | Freshwater Sediment | RKRNMALYDDAGFVSHHEAEQALEAARDYIRVIRADITTRQP |
Ga0187865_10461011 | 3300018004 | Peatland | DRLRRKRNMALYDDTGFVSHHEAEEALESAHNFIDVIRADITTRKL |
Ga0187878_12462581 | 3300018005 | Peatland | KRNLALYDDTGFVSQHDAKQALQAASDYLAVMRADIIARKP |
Ga0187873_10793002 | 3300018013 | Peatland | RRKRNTALYDDSGFVSLHDAEEAITTARDYLAVIGANIDARRPKA |
Ga0187866_13387822 | 3300018015 | Peatland | RRKRNTALYDDSGFVSRHDAEEAITTARDYPAVIGADIDARRPKA |
Ga0187880_11307262 | 3300018016 | Peatland | NMALYDDSGFVSYHDAEEALQAARNFLGVIRADINTRKP |
Ga0187861_104141071 | 3300018020 | Peatland | FDRLRRKRNTALYDDTGFVSHRDAEQALESAGEYLNVIRADIGDRKP |
Ga0187864_104139741 | 3300018022 | Peatland | TLFDRLRRKRNVALYDDTGFVSRHEAEEALESARNFIDVIRADITARKP |
Ga0187851_104115483 | 3300018046 | Peatland | YDDTGFVSHHDAEQALESAGDYLNVIRADIAARKP |
Ga0187770_104589271 | 3300018090 | Tropical Peatland | MFDRLRRKRNVALYDDTGFVSHLDAVEALEAAADYLNVIQADIAVRKP |
Ga0187770_117896641 | 3300018090 | Tropical Peatland | RNLALYDDTGFVSRHDAEQALETAREYIAVIRADLDARKP |
Ga0187852_14274551 | 3300019082 | Peatland | RRKRNMALYDDTGFVSHHDAEQALQSAGDYLNVIRADIAVRKP |
Ga0187797_14942401 | 3300019284 | Peatland | LYDDTGFVSRHDAEQALASAGDYLEVIRADITARKP |
Ga0210399_100708604 | 3300020581 | Soil | MALYDDTGFVSHHDAEQALESARDFIEVVRADITARKP |
Ga0210406_1000065251 | 3300021168 | Soil | MTTRDLVSHHDAERALEAARDYLEVIRADVTARKP |
Ga0210397_116093531 | 3300021403 | Soil | LRRKRNTALYDDTGFVSHHDAEQALESACDYLNVIRVDIAGRKP |
Ga0210391_108321282 | 3300021433 | Soil | LYDDIGFVSRHDAEQALETARQYLKVIRTEIGARKP |
Ga0209521_100487194 | 3300025164 | Soil | MVLYDDTGFVSHQDAQQALKTAHEYLNVIRADVAARKA |
Ga0208689_10348552 | 3300025459 | Peatland | FDRLRRKRNTALYDDSGFVSLHDAEEAITTARDYLAVIGANIDARRPKA |
Ga0208191_11006851 | 3300025496 | Peatland | FDRLRRKRNTALYDDTGFVSHHDAEQALESAGDYLNVIRVDIAARKP |
Ga0208563_11072371 | 3300025501 | Peatland | LFDRLRRKRNVALYDDTGFVSRHEAEEALESARNFIDVIRADITARKP |
Ga0207677_122052492 | 3300026023 | Miscanthus Rhizosphere | VFDSFRRKRKLALYDDTAFVSHQDAEQSLEAARDYLAVICADVTARKP |
Ga0209238_100672410 | 3300026301 | Grasslands Soil | MALYDDTGFVSHHDAEQALEAARDYLGVVRADITARKP |
Ga0209009_10716122 | 3300027667 | Forest Soil | LYDDTGLVSHHDAEQALESASHYLKVIRNDISARKP |
Ga0209588_12391441 | 3300027671 | Vadose Zone Soil | RLRRKRNLALYDDTGFVSRQDAEQALKTARDYIHVIRADITARKP |
Ga0209689_11733221 | 3300027748 | Soil | RRKRNMALYDDTGFVSHHDAEQALEAARDYLGVVRADITARKP |
Ga0209655_102247841 | 3300027767 | Bog Forest Soil | KRNMALYDDTGFISCHDAEQALEAGHDYSRVLRADIAARKP |
Ga0209698_102636631 | 3300027911 | Watersheds | KRNTALYDDTGFVSHHDAEQALESAGDYLNVIRADIVARKP |
Ga0209698_109727121 | 3300027911 | Watersheds | TALYDDTGFVSRHDAEQALESAVDYLNVIRADIADRKP |
Ga0302144_102215181 | 3300028560 | Bog | SGPYDDTGFVSRHDAEQALESASEYLNVIRTDIVARRP |
Ga0302222_101273832 | 3300028798 | Palsa | NAALYDDTGFVSHRDAEQALESAGDYLNIVRVDIAARKP |
Ga0222749_102974842 | 3300029636 | Soil | NTALYDDTGFVSHHEAEQSLETARDYLRVIRGDIAVRRP |
Ga0302176_103621892 | 3300030057 | Palsa | RRKRNTALYDDTGFVSRHDAEEAITTAHDYLAVIGADIGTRKPKA |
Ga0302325_128304391 | 3300031234 | Palsa | RRKRNTALYDDTGFVSRHDAEQALESAGDYLNVIRADIAARKP |
Ga0265330_101334692 | 3300031235 | Rhizosphere | MALYEDTGFVSHHDAQHALETAREYLVIIRTNIAARKP |
Ga0302324_1017358612 | 3300031236 | Palsa | RNMALYDDSGFVSHHDAEQAIEAARGFLVVIRADINFRKP |
Ga0302326_115104002 | 3300031525 | Palsa | MALYDDTGFVSRCNAEQALESAREFITVIRADIDARKT |
Ga0302326_132405062 | 3300031525 | Palsa | LFDRLRRKRNMALYDDSGFVSHHDAEQAIEAARGFLVVIRADINSRRP |
Ga0310686_1029695121 | 3300031708 | Soil | LYDDTGFVSHHDAEQALESAGDYLNMIRADVAARKP |
Ga0306923_125046231 | 3300031910 | Soil | FDRLRRKRNMALYDDTGFVSRHDAEQAMESARNLIGVIRADITARKP |
Ga0307472_1018344221 | 3300032205 | Hardwood Forest Soil | FVDETGFVSHHDAERALESAGDYLNVIRADIAARKP |
Ga0335085_1000337713 | 3300032770 | Soil | MALYDDAGFVSRHKAEQALEAAREYLGVIHADVTARKP |
Ga0335082_100956353 | 3300032782 | Soil | MAIYDDTGFVSHHDAEQALESAREYLGVIRADITAREP |
Ga0335079_101243851 | 3300032783 | Soil | MALYDDTGFVSHHDAEQALESARDYIGVIRADITARKP |
Ga0335078_101788346 | 3300032805 | Soil | MALYDDTGFVSHHDVEQALESARDYIGVIRADIAARKP |
Ga0335076_102239182 | 3300032955 | Soil | MALYDDTGFVSHHDVEQALESARDYLGVIRADITA |
Ga0335077_102578342 | 3300033158 | Soil | MALYDDTGFVSHHDAEQALESARDYIGVIRADMTA |
Ga0326728_100490713 | 3300033402 | Peat Soil | VRHDDTGFVSRHDPEGALAAADGYLAVIGADIDSRKPKP |
Ga0334818_072716_394_516 | 3300033821 | Soil | TALYDDTGFVSRHDAEEAITTARDYLAVIGADIDARRPKA |
Ga0334837_127768_370_501 | 3300033823 | Soil | KRNTALYDDTGFVSRHDAEEAITTARDYLAVIGADIDARRPKA |
Ga0314861_0337455_547_669 | 3300033977 | Peatland | RDTALYDDTGFVSYHDAEEALKAARDYLGVIGAEINARRP |
Ga0370483_0095083_2_145 | 3300034124 | Untreated Peat Soil | FDRLRRKRNTALYDDSGFVSRYDAEQALESARDYLTVIQADIAARKP |
⦗Top⦘ |