| Basic Information | |
|---|---|
| Family ID | F098796 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTPQPSDWRSVAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH |
| Number of Associated Samples | 57 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.29 % |
| % of genes near scaffold ends (potentially truncated) | 13.59 % |
| % of genes from short scaffolds (< 2000 bps) | 70.87 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.311 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil (13.592 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.330 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.427 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 11.65 |
| PF13545 | HTH_Crp_2 | 9.71 |
| PF00589 | Phage_integrase | 2.91 |
| PF00501 | AMP-binding | 1.94 |
| PF01850 | PIN | 1.94 |
| PF04892 | VanZ | 0.97 |
| PF13185 | GAF_2 | 0.97 |
| PF04366 | Ysc84 | 0.97 |
| PF00069 | Pkinase | 0.97 |
| PF05985 | EutC | 0.97 |
| PF03631 | Virul_fac_BrkB | 0.97 |
| PF01867 | Cas_Cas1 | 0.97 |
| PF00115 | COX1 | 0.97 |
| PF00392 | GntR | 0.97 |
| PF12833 | HTH_18 | 0.97 |
| PF00027 | cNMP_binding | 0.97 |
| PF01593 | Amino_oxidase | 0.97 |
| PF03626 | COX4_pro | 0.97 |
| PF00892 | EamA | 0.97 |
| PF05598 | DUF772 | 0.97 |
| PF04055 | Radical_SAM | 0.97 |
| PF00534 | Glycos_transf_1 | 0.97 |
| PF00196 | GerE | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.97 |
| COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 0.97 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.97 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.97 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.31 % |
| Unclassified | root | N/A | 43.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10117169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1886 | Open in IMG/M |
| 3300002915|JGI25387J43893_1018090 | Not Available | 968 | Open in IMG/M |
| 3300004139|Ga0058897_11173501 | Not Available | 528 | Open in IMG/M |
| 3300004479|Ga0062595_101358050 | Not Available | 644 | Open in IMG/M |
| 3300005167|Ga0066672_10329752 | Not Available | 995 | Open in IMG/M |
| 3300005175|Ga0066673_10053859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2039 | Open in IMG/M |
| 3300005176|Ga0066679_10213578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
| 3300005179|Ga0066684_10111027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1694 | Open in IMG/M |
| 3300005179|Ga0066684_11101820 | Not Available | 508 | Open in IMG/M |
| 3300005435|Ga0070714_100013181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6617 | Open in IMG/M |
| 3300005435|Ga0070714_100151064 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300005435|Ga0070714_100275223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1562 | Open in IMG/M |
| 3300005435|Ga0070714_100533639 | Not Available | 1122 | Open in IMG/M |
| 3300005435|Ga0070714_100540670 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300005435|Ga0070714_100891163 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005436|Ga0070713_100383862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
| 3300005437|Ga0070710_11223049 | Not Available | 556 | Open in IMG/M |
| 3300005437|Ga0070710_11482070 | Not Available | 509 | Open in IMG/M |
| 3300005454|Ga0066687_10532552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300005534|Ga0070735_10000691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 35020 | Open in IMG/M |
| 3300005534|Ga0070735_10004585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11600 | Open in IMG/M |
| 3300005534|Ga0070735_10004800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11310 | Open in IMG/M |
| 3300005534|Ga0070735_10115882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1678 | Open in IMG/M |
| 3300005534|Ga0070735_10332790 | Not Available | 913 | Open in IMG/M |
| 3300005539|Ga0068853_101201561 | Not Available | 732 | Open in IMG/M |
| 3300005560|Ga0066670_10397134 | Not Available | 845 | Open in IMG/M |
| 3300005563|Ga0068855_102095372 | Not Available | 570 | Open in IMG/M |
| 3300005575|Ga0066702_10150397 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300005587|Ga0066654_10327000 | Not Available | 829 | Open in IMG/M |
| 3300006028|Ga0070717_10131726 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300006028|Ga0070717_11029347 | Not Available | 750 | Open in IMG/M |
| 3300006032|Ga0066696_10240039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300006032|Ga0066696_10715292 | Not Available | 642 | Open in IMG/M |
| 3300006893|Ga0073928_10000626 | All Organisms → cellular organisms → Bacteria | 79453 | Open in IMG/M |
| 3300006893|Ga0073928_10000628 | All Organisms → cellular organisms → Bacteria | 79319 | Open in IMG/M |
| 3300006893|Ga0073928_10000968 | All Organisms → cellular organisms → Bacteria | 59010 | Open in IMG/M |
| 3300007819|Ga0104322_131764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1617 | Open in IMG/M |
| 3300007819|Ga0104322_138713 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300007982|Ga0102924_1015227 | All Organisms → cellular organisms → Bacteria | 6023 | Open in IMG/M |
| 3300009093|Ga0105240_10004411 | All Organisms → cellular organisms → Bacteria | 21467 | Open in IMG/M |
| 3300009093|Ga0105240_10034008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6580 | Open in IMG/M |
| 3300009093|Ga0105240_10178358 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300009093|Ga0105240_12669125 | Not Available | 516 | Open in IMG/M |
| 3300009545|Ga0105237_10606522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300009545|Ga0105237_10850016 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300009551|Ga0105238_10053741 | All Organisms → cellular organisms → Bacteria | 4047 | Open in IMG/M |
| 3300010321|Ga0134067_10410821 | Not Available | 544 | Open in IMG/M |
| 3300010371|Ga0134125_10653674 | Not Available | 1161 | Open in IMG/M |
| 3300010371|Ga0134125_11169939 | Not Available | 841 | Open in IMG/M |
| 3300010373|Ga0134128_12463103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010373|Ga0134128_12729044 | Not Available | 544 | Open in IMG/M |
| 3300010373|Ga0134128_12806470 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010396|Ga0134126_10028649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7058 | Open in IMG/M |
| 3300010396|Ga0134126_10081900 | All Organisms → cellular organisms → Bacteria | 3993 | Open in IMG/M |
| 3300010396|Ga0134126_10156408 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300010396|Ga0134126_11329077 | Not Available | 796 | Open in IMG/M |
| 3300010399|Ga0134127_12371571 | Not Available | 610 | Open in IMG/M |
| 3300011120|Ga0150983_12391720 | Not Available | 1876 | Open in IMG/M |
| 3300011120|Ga0150983_14396585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300012469|Ga0150984_101425174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1181 | Open in IMG/M |
| 3300013104|Ga0157370_10814746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300013307|Ga0157372_10477225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
| 3300018431|Ga0066655_10259052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300018433|Ga0066667_12164950 | Not Available | 517 | Open in IMG/M |
| 3300018468|Ga0066662_10916859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300019888|Ga0193751_1095403 | Not Available | 1155 | Open in IMG/M |
| 3300020579|Ga0210407_10214641 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300020579|Ga0210407_10510568 | Not Available | 939 | Open in IMG/M |
| 3300021168|Ga0210406_10172062 | Not Available | 1809 | Open in IMG/M |
| 3300021168|Ga0210406_10303672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300021479|Ga0210410_10361939 | Not Available | 1301 | Open in IMG/M |
| 3300022557|Ga0212123_10000509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 125835 | Open in IMG/M |
| 3300022557|Ga0212123_10001130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 77332 | Open in IMG/M |
| 3300022557|Ga0212123_10001496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 64602 | Open in IMG/M |
| 3300022557|Ga0212123_10014025 | All Organisms → cellular organisms → Bacteria | 10308 | Open in IMG/M |
| 3300025898|Ga0207692_10986813 | Not Available | 556 | Open in IMG/M |
| 3300025913|Ga0207695_10044785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4703 | Open in IMG/M |
| 3300025913|Ga0207695_10049749 | All Organisms → cellular organisms → Bacteria | 4414 | Open in IMG/M |
| 3300025913|Ga0207695_10058420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4004 | Open in IMG/M |
| 3300025913|Ga0207695_10085979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 3173 | Open in IMG/M |
| 3300025915|Ga0207693_10913715 | Not Available | 673 | Open in IMG/M |
| 3300025928|Ga0207700_10244697 | Not Available | 1530 | Open in IMG/M |
| 3300025929|Ga0207664_10158652 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300025929|Ga0207664_10196109 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300025929|Ga0207664_10312404 | Not Available | 1385 | Open in IMG/M |
| 3300025929|Ga0207664_10873178 | Not Available | 808 | Open in IMG/M |
| 3300025929|Ga0207664_11080873 | Not Available | 717 | Open in IMG/M |
| 3300025929|Ga0207664_11568277 | Not Available | 580 | Open in IMG/M |
| 3300025929|Ga0207664_11828717 | Not Available | 530 | Open in IMG/M |
| 3300025929|Ga0207664_11905891 | Not Available | 517 | Open in IMG/M |
| 3300026300|Ga0209027_1025595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2235 | Open in IMG/M |
| 3300026301|Ga0209238_1100000 | Not Available | 984 | Open in IMG/M |
| 3300026301|Ga0209238_1110328 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300026550|Ga0209474_10247938 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300026550|Ga0209474_10525410 | Not Available | 600 | Open in IMG/M |
| 3300026552|Ga0209577_10720173 | Not Available | 562 | Open in IMG/M |
| 3300027587|Ga0209220_1134907 | Not Available | 641 | Open in IMG/M |
| 3300027635|Ga0209625_1133959 | Not Available | 555 | Open in IMG/M |
| 3300027986|Ga0209168_10000849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26881 | Open in IMG/M |
| 3300027986|Ga0209168_10013589 | All Organisms → cellular organisms → Bacteria | 4757 | Open in IMG/M |
| 3300027986|Ga0209168_10231571 | Not Available | 918 | Open in IMG/M |
| 3300031740|Ga0307468_101670996 | Not Available | 598 | Open in IMG/M |
| 3300034644|Ga0370548_060873 | Not Available | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 13.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 10.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 9.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 7.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101171694 | 3300001593 | Forest Soil | MTPQPRDWRRVAEEVRDEQDSIKMMALVIELDRLLENEDKSRKRPH* |
| JGI25387J43893_10180902 | 3300002915 | Grasslands Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRILEREEKARKRSR* |
| Ga0058897_111735012 | 3300004139 | Forest Soil | GRFPMTPQPSNRRHEAERICYEKDSNKMMELVFELDRLLECEDKSRKRPH* |
| Ga0062595_1013580502 | 3300004479 | Soil | MTPQPSNWRSIAEQICDEKDSNKMMALVFELDRLLERDEKFRKRSH* |
| Ga0066672_103297522 | 3300005167 | Soil | MTPQPSDWRSVAEQISDEKDSNKMMALVVELDRLLEREEKPRKRSH* |
| Ga0066673_100538592 | 3300005175 | Soil | MTPQSSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKTRKRSH* |
| Ga0066679_102135781 | 3300005176 | Soil | MTPQPSDWRSVAEQISDEKDSNKMMALVAELDRLLEREEKARKRSH* |
| Ga0066684_101110273 | 3300005179 | Soil | MIPMTPQPSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKTRKRSH* |
| Ga0066684_111018201 | 3300005179 | Soil | VTPQPRDWRRVAEEVRDEKDSAKMMALVIELDHLLEKEDKARRRPHCRAWMIN* |
| Ga0070714_10001318110 | 3300005435 | Agricultural Soil | MTPQPRDWRRVAEQVRDEKDSSKMMALVIELDRLLENEDKSRKRPH* |
| Ga0070714_1001510644 | 3300005435 | Agricultural Soil | MTPQPRDWRRVAEEARDEKDSVKMMALIIELDSLLEKEDKTRRRPH* |
| Ga0070714_1002752234 | 3300005435 | Agricultural Soil | NQKLKGGLPMTPQPSNWRFVAEQICDEKDSDKMMALVVELDRLLERDEKSRKHQQH* |
| Ga0070714_1005336393 | 3300005435 | Agricultural Soil | MTPQPRDWRRVAEEVRDEKDSTKMMALFVELDRLLENEDKSRKRPH* |
| Ga0070714_1005406702 | 3300005435 | Agricultural Soil | MSPQPGDWRSVAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH* |
| Ga0070714_1008911632 | 3300005435 | Agricultural Soil | MTPQPSDWRSVAEQICDEKDSNKMMALVFELDRLLERDEKFRKRSH* |
| Ga0070713_1003838622 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQQPSNWRPVAEQICDEKDSTKMMALVIELNRLLERDEKSRKQQQQH* |
| Ga0070710_112230491 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQPRDWRRVAEEVRDEKDSIKMMALVIELDRLLEREDKSRQRPH* |
| Ga0070710_114820701 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQPSDWRYVAERVCMEKDSNKMIALVMELNRLLEREQSNKRTH* |
| Ga0066687_105325521 | 3300005454 | Soil | MIPMTPQPSDWRSLAEQICDEKDSNKMMALVVELDRILEREEKARKRSH* |
| Ga0070735_1000069130 | 3300005534 | Surface Soil | MTPQPRDWRCVAEQIRDERDSKKMMDLVVELDRLLESEDKSRRRPH* |
| Ga0070735_100045857 | 3300005534 | Surface Soil | MTPQPSNWRSVAEQICDEKNSDKMMALVFELDRLLERDEKARKQQQH* |
| Ga0070735_1000480014 | 3300005534 | Surface Soil | MTPQPRDWRLVAEQIRDEKDSNKMMELVVELDCLLERDENARKHPHNLCA* |
| Ga0070735_101158823 | 3300005534 | Surface Soil | MTPQPRDWRSVAEQIADEKNSDKMMALVFELNRLLERDEKSRKHQQQ* |
| Ga0070735_103327902 | 3300005534 | Surface Soil | MTPQPRTPQPRDWRYVAEQIRDEKDSKKMMDLVVELDRLLESEDKSRRRPHYQLPKL* |
| Ga0068853_1012015613 | 3300005539 | Corn Rhizosphere | SPMTPQPRDWRRVAEQVRDEKDSSKLMVLVIELNRLLENEDKSRKRPH* |
| Ga0066670_103971342 | 3300005560 | Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH* |
| Ga0068855_1020953722 | 3300005563 | Corn Rhizosphere | MTPQPRDWRRVAEQLRDEKDSSKMMALVIELDRLLENEDKSRKRPH* |
| Ga0066702_101503972 | 3300005575 | Soil | MTPQPSNWRSLAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH* |
| Ga0066654_103270002 | 3300005587 | Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKTRKRSH* |
| Ga0070717_101317263 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQPRDWRYVAKQICDERDSNKMMELVVELDRLLEREEKSRKQH* |
| Ga0070717_110293472 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQQPSNWRPVAEQICDEKDSTKMMALVIELNRLLERDEKARKQQQQH* |
| Ga0066696_102400392 | 3300006032 | Soil | VTPQPRDWRRVAEEVRDEKDSVKMMALVIELDRLLEKEDKSRRRPH* |
| Ga0066696_107152921 | 3300006032 | Soil | LIPMTPQPSGWRSLAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH* |
| Ga0073928_1000062676 | 3300006893 | Iron-Sulfur Acid Spring | MTPQPRDWRRVAEEVRDEKDSNKMMALVIELDHLLECEDKSRKRPH* |
| Ga0073928_1000062842 | 3300006893 | Iron-Sulfur Acid Spring | MTPQPRDWRRVAEEVRDEKDSIKMMALVIELDRLLECEDKSRRRPH* |
| Ga0073928_1000096857 | 3300006893 | Iron-Sulfur Acid Spring | MTPQPRDWRRVAEEVRDEKDSMKMMALVIELDRLLESEDKSRKRSH* |
| Ga0104322_1317643 | 3300007819 | Permafrost Soil | MTPQPRDWRRVAEQVCDEKDSIKMMALVIELDHLLENEDKSRKRPH* |
| Ga0104322_1387132 | 3300007819 | Permafrost Soil | MTPQPNNWRYVAEQICDEKDSIKMMTLVIELDRLLEYEDKSRKPQQH* |
| Ga0102924_10152277 | 3300007982 | Iron-Sulfur Acid Spring | MTPQPSDWRHVAEQIRDEKDSTKMMALVIELDRLLEREDKSRKPQH* |
| Ga0105240_100044116 | 3300009093 | Corn Rhizosphere | MTPQPRTPQPSDWRYVAEQIRDEKDSKKMMDLVAELDRLLESEDKSRRRPH* |
| Ga0105240_100340081 | 3300009093 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSSKLMVLVIELNRLLENEDKSRKRPH* |
| Ga0105240_101783583 | 3300009093 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSSKMMALVIELNRLLENEDKSRKRSH* |
| Ga0105240_126691251 | 3300009093 | Corn Rhizosphere | TPQPRDWRRVAEQLRDEKDSSKMMALVIELDRLLERDEKFRKRSH* |
| Ga0105237_106065221 | 3300009545 | Corn Rhizosphere | RTLQPRDWRYVAEQIRDEKDSKKMMDLVVELDRLLESEDKSRRRRY* |
| Ga0105237_108500162 | 3300009545 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSSKMMALVIELNRLLENEDMSRKRPH* |
| Ga0105238_100537413 | 3300009551 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSNKLMALVIELARLLESEDKSRKRPH* |
| Ga0134067_104108211 | 3300010321 | Grasslands Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRILEREEKARKRSH* |
| Ga0134125_106536742 | 3300010371 | Terrestrial Soil | MTPQPSDWRSVAEQICDEKNSNKMMALVVELDRLFEREEKARKSSH* |
| Ga0134125_111699391 | 3300010371 | Terrestrial Soil | MTPQPRDWRCVAEQIRDEKDSKKMMALVVELDRLMESEDKSRRRPH* |
| Ga0134128_124631031 | 3300010373 | Terrestrial Soil | MTPQPRDWRRVAEQLRDEKDSSKMMALVIELDRLLENEDKSRKR |
| Ga0134128_127290441 | 3300010373 | Terrestrial Soil | MTPQPRTLQPRDWRYVAEQIRDEKDSKKMMDLVVELDRLLESEDKSRRRRY* |
| Ga0134128_128064702 | 3300010373 | Terrestrial Soil | MTPQPRDWRRVAEEVRDEKDSTKMMALVIELDRLLENEDR |
| Ga0134126_100286498 | 3300010396 | Terrestrial Soil | MTPQPRDWRCVAEQIRDEKDSKKMMDLVVELDRLLESEDKSRRRPH* |
| Ga0134126_100819001 | 3300010396 | Terrestrial Soil | MTPQPSDWRLVAAQVRDEKDPNKMMALVIELDRLLERDEKTRKRSR* |
| Ga0134126_101564082 | 3300010396 | Terrestrial Soil | MTPQPCNWRSIAEQICDEKDSNKMMALVFELDRLLERDEKFRKRSH* |
| Ga0134126_113290772 | 3300010396 | Terrestrial Soil | MTPQPRDWRRVAEEVRDEKDSTKMMALVIELDRLLENEDRSRKRPHPGRDLAKAWK* |
| Ga0134127_123715712 | 3300010399 | Terrestrial Soil | QKQKGGFSMTPQPRTLQPRDWRYVAEQIRDEKDSKKMMDLVVELDRLLESEDKSRRRRY* |
| Ga0150983_123917202 | 3300011120 | Forest Soil | LYSRNTEGRFPMTPQPRTPQPRDWRYVAEQIRDEEDSKKMMELVVELDRLLESEDKSRKRPH* |
| Ga0150983_143965851 | 3300011120 | Forest Soil | ETRNREGRFPMTPQPRDWRRVAEEVRDEKDSIKMMALVIELDRLLEREDESRKRPH* |
| Ga0150984_1014251741 | 3300012469 | Avena Fatua Rhizosphere | MTPQPSDWRSIAAQICDEKDSNKMMALVVELDRLLEREEKARKRSH* |
| Ga0157370_108147461 | 3300013104 | Corn Rhizosphere | KYMTPQPRTPQPSDWRYVAEQIRDEKDSKKMMDLVVELDRLLESDDKSRRRPH* |
| Ga0157372_104772252 | 3300013307 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSNKLIALVIELDRLLESEDKSRKRPH* |
| Ga0066655_102590522 | 3300018431 | Grasslands Soil | MTPQPSDWRSVAEQISDEKDSNKMMALVVELDRLLEREEKTRKRSH |
| Ga0066667_121649501 | 3300018433 | Grasslands Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKTRKRSH |
| Ga0066662_109168591 | 3300018468 | Grasslands Soil | MTPQSSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKTRKRSH |
| Ga0193751_10954031 | 3300019888 | Soil | MTPQPRDWRCVAEQICDEKDSIKMMELVVELDRLLEREDKSRKRPH |
| Ga0210407_102146414 | 3300020579 | Soil | MTPQPSDWRYVAEQICDEKDSNKMMELVVELDRLLEREDKSRKRPH |
| Ga0210407_105105681 | 3300020579 | Soil | MTPQPRTPQPRDWRYVAEQIRDEEDSKKMMELVVELDRLLESEDKSRKRPH |
| Ga0210406_101720621 | 3300021168 | Soil | MTPQPRTSQPRDWRYVAEQIRDEKDSKKMMELVVELDRLLESEDKSRKPPH |
| Ga0210406_103036721 | 3300021168 | Soil | MTPQPSNRRHEAERICYEKDSNKMMELVFELDRLLECED |
| Ga0210410_103619392 | 3300021479 | Soil | MTPQPRDWRRVAEQVRDEKDSTKMMALVIELDRLLECEDKSRKRPH |
| Ga0212123_1000050997 | 3300022557 | Iron-Sulfur Acid Spring | MTPQPRDWRRVAEEVRDEKDSMKMMALVIELDRLLESEDKSRKRSH |
| Ga0212123_1000113061 | 3300022557 | Iron-Sulfur Acid Spring | MTPQPRDWRRVAEEVRDEKDSIKMMALVIELDRLLECEDKSRRRPH |
| Ga0212123_1000149634 | 3300022557 | Iron-Sulfur Acid Spring | MTPQPRDWRRVAEEVRDEKDSNKMMALVIELDHLLECEDKSRKRPH |
| Ga0212123_100140255 | 3300022557 | Iron-Sulfur Acid Spring | MTPQPSDWRHVAEQIRDEKDSTKMMALVIELDRLLEREDKSRKPQH |
| Ga0207692_109868131 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQPRDWRRVAEEVRDEKDSIKMMALVIELDRLLEREDKSRQRPH |
| Ga0207695_100447851 | 3300025913 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSSKLMVLVIELNRLLENEDKSRKRPH |
| Ga0207695_100497494 | 3300025913 | Corn Rhizosphere | MTPQPRDWRRVAEQLRDEKDSSKMMALVIELDRLLENEDKSRKRPH |
| Ga0207695_100584205 | 3300025913 | Corn Rhizosphere | MTPQPRDWRRVAEQVRDEKDSSKMMALVIELNRLLENEDMSRKRPH |
| Ga0207695_100859794 | 3300025913 | Corn Rhizosphere | MTPQPRTPQPSDWRYVAEQIRDEKDSKKMMDLVAELDRLLESEDKSRRRPH |
| Ga0207693_109137151 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQPSNWRFVAEQICDEKDSDKMMALVVELDRLLER |
| Ga0207700_102446973 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPQQPSNWRPVAEQICDEKDSTKMMALVIELNRLLERDEKSRKQQQQH |
| Ga0207664_101586522 | 3300025929 | Agricultural Soil | MSPQPGDWRSVAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH |
| Ga0207664_101961092 | 3300025929 | Agricultural Soil | MTPQPRDWRRVAEEARDEKDSVKMMALIIELDSLLEKEDKTRRRPH |
| Ga0207664_103124042 | 3300025929 | Agricultural Soil | MTPQPRDWRRVAEQVRDEKDSNKLIALVIELDRLLESEDKSRKRPH |
| Ga0207664_108731781 | 3300025929 | Agricultural Soil | MTPQPCNWRSIAEQICDEKDSNKMMALVFELDRLLERDEKFRKRSH |
| Ga0207664_110808731 | 3300025929 | Agricultural Soil | MTPQPSNWRFVAEQICDEKDSDKMMALVVELDRLLERDEKSRKHQQH |
| Ga0207664_115682771 | 3300025929 | Agricultural Soil | REIEGRFSMTPQPRDWRRVAEEVRDEKDSTKMMALFVELDRLLENEDKSRKRPH |
| Ga0207664_118287171 | 3300025929 | Agricultural Soil | MTPQPSDWRSVAEQICDEKDSNKMMALVVELDCLLEREEKARKR |
| Ga0207664_119058911 | 3300025929 | Agricultural Soil | MTPLQPSNWQTVAEQICDEKNSDKMMALVVELDRLLERDEKSRKHQQH |
| Ga0209027_10255953 | 3300026300 | Grasslands Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH |
| Ga0209238_11000001 | 3300026301 | Grasslands Soil | MIPMTPQPSDWRSLAEQICDEKDSNKMMALVVELDRILEREEKARKRSH |
| Ga0209238_11103281 | 3300026301 | Grasslands Soil | MTPQPSDWRSLAEQICDEKDSNKMMALVVELDRILEREEKPRQRSR |
| Ga0209474_102479381 | 3300026550 | Soil | MTPQPSDWRSVAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH |
| Ga0209474_105254102 | 3300026550 | Soil | MTPQPSDWRSVAEQISDEKDSNKMMALVVELDRLLEREEKPRKRSH |
| Ga0209577_107201732 | 3300026552 | Soil | MTPQPSNWRSLAEQICDEKDSNKMMALVVELDRLLEREEKARKRSH |
| Ga0209220_11349071 | 3300027587 | Forest Soil | MTPQPRDWRRVAEEVRDEKDSIKMMALVIELDRLLECEDKSRKRPH |
| Ga0209625_11339592 | 3300027635 | Forest Soil | MTPQPSNWRYVAEQICDEKDSNKMMELVFELDRLLEREDKSRKRPH |
| Ga0209168_1000084930 | 3300027986 | Surface Soil | MTPQPRDWRCVAEQIRDERDSKKMMDLVVELDRLLESEDKSRRRPH |
| Ga0209168_100135896 | 3300027986 | Surface Soil | MTPQPRDWRLVAEQIRDEKDSNKMMELVVELDCLLERDENARKHPHNLCA |
| Ga0209168_102315712 | 3300027986 | Surface Soil | MTPQPSNWRSVAEQICDEKNSDKMMALVFELDRLLERDEKARKQQQH |
| Ga0307468_1016709962 | 3300031740 | Hardwood Forest Soil | MTPQPNNWRYVAEQICDEKDSNKMMALVIELDRLLEREDKSRKPQQH |
| Ga0370548_060873_29_169 | 3300034644 | Soil | MTPQPRDWRRVAEEVRDEKDSDKMMALVIELDRLLENEDKSRKRPH |
| ⦗Top⦘ |